Recombinant Human PRTFDC1 protein (ab108126)

Overview

  • Product name
    Recombinant Human PRTFDC1 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGSMAGSSEEAPDYGRGVVIMDDWPGYDLN LFTYPQHYYGDLEYVLIPHGIIVDRIERLAKDIMKDIGYSDIMVLCVLKG GYKFCADLVEHLKNISRNSDRFVSMKVDFIRLKSYRNDQSMGEMQIIGGD DLSTLAGKNVLIVEDVVGTGRTMKALLSNIEKYKPNMIKVASLLVKRTSR SDGFRPDYAGFEIPNLFVVGYALDYNEYFRDLNHICVINEHGKEKYRV
    • Molecular weight
      28 kDa including tags
    • Amino acids
      1 to 225
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab108126 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 95 % SDS-PAGE.
    ab108126 was purified using conventional chromatography.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: 40% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • FLJ11888
    • HHGP
    • OTTHUMP00000019332
    • Phosphoribosyl transferase domain containing 1
    • phosphoribosyltransferase domain containing protein 1
    • Phosphoribosyltransferase domain-containing protein 1
    • PRDC1_HUMAN
    • prtfdc1
    • Uncharacterized protein PRTFDC1
    see all
  • Sequence similarities
    Belongs to the purine/pyrimidine phosphoribosyltransferase family.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3µg ab108126.

References

ab108126 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab108126.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up