Recombinant Human PRTFDC1 protein (ab108126)

Overview

  • Product nameRecombinant Human PRTFDC1 protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionQ9NRG1
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMGSMAGSSEEAPDYGRGVVIMDDWPGYDLN LFTYPQHYYGDLEYVLIPHGIIVDRIERLAKDIMKDIGYSDIMVLCVLKG GYKFCADLVEHLKNISRNSDRFVSMKVDFIRLKSYRNDQSMGEMQIIGGD DLSTLAGKNVLIVEDVVGTGRTMKALLSNIEKYKPNMIKVASLLVKRTSR SDGFRPDYAGFEIPNLFVVGYALDYNEYFRDLNHICVINEHGKEKYRV
    • Molecular weight28 kDa including tags
    • Amino acids1 to 225
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab108126 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 95 % SDS-PAGE.
    ab108126 was purified using conventional chromatography.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: 40% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • FLJ11888
    • HHGP
    • OTTHUMP00000019332
    • Phosphoribosyl transferase domain containing 1
    • phosphoribosyltransferase domain containing protein 1
    • Phosphoribosyltransferase domain-containing protein 1
    • PRDC1_HUMAN
    • prtfdc1
    • Uncharacterized protein PRTFDC1
    see all
  • Sequence similaritiesBelongs to the purine/pyrimidine phosphoribosyltransferase family.
  • Information by UniProt

Recombinant Human PRTFDC1 protein images

  • 15% SDS-PAGE analysis of 3µg ab108126.

References for Recombinant Human PRTFDC1 protein (ab108126)

ab108126 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab108126.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"