Overview

  • Product name
    Recombinant Human PRUNE protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MEDYLQGCRAALQESRPLHVVLGNEACDLDSTVSALALAFYLAKTTEAEE VFVPVLNIKRSELPLRGDIVFFLQKVHIPESILIFRDEIDLHALYQAGQL TLILVDHHILSKSDTALEEAVAEVLDHRPIEPKHCPPCHVSVELVGSCAT LVTERILQGAPEILDRQTAALLHGTIILDCVNMDLKIGKATPKDSKYVEK LEALFPDLPKRNDIFDSLQKAKFDVSGLTTEQMLRKDQKTIYRQGVKVAI SAIYMDLEAFLQRSNLLADLHAFCQAHSYDVLVAMTIFFNTHNEPVRQLA IFCPHVALQTTICEVLERSHSPPLKLTPASSTHPNLHAYLQGNTQVSRKK LLPLLQEALSAYFDSMKIPSGQPETADVSREQVDKELDRASNSLISGLSQ DEEDPPLPPTPMNSLVDECPLDQGLPKLSAEAVFEKCSQISLSQSTTASL SKK
    • Amino acids
      1 to 453
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153466 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • DRES-17
    • DRES17
    • Drosophila-related expressed sequence 17
    • hPrune
    • HTcD37
    • Protein prune homolog
    • PRUNE
    • Prune homolog
    • PRUNE like protein
    • PRUNE_HUMAN
    • TcD37 homolog
    see all
  • Function
    Phosphodiesterase (PDE) that has higher activity toward cAMP than cGMP, as substrate. Plays a role in cell proliferation, is able to induce cell motility and acts as a negative regulator of NME1.
  • Tissue specificity
    Ubiquitously expressed. Seems to be overexpressed in aggressive sarcoma subtypes, such as leiomyosarcomas and malignant fibrous histiocytomas (MFH) as well as in the less malignant liposarcomas.
  • Sequence similarities
    Belongs to the PPase class C family. Prune subfamily.
  • Cellular localization
    Cytoplasm. Nucleus. Cell junction > focal adhesion. In some transfected cells a nuclear staining is also observed.
  • Information by UniProt

Images

  • ab153466 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153466 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153466.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up