Overview

  • Product name
    Recombinant Human PSCA protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      CYSCKAQVSNEDCLQVENCTQLGEQCWTARIRAVGLLTVISKGCSLNCVD DSQDYYVGKKNITCCDTDLCNAS
    • Amino acids
      23 to 95
    • Tags
      proprietary tag N-Terminus

Associated products

Specifications

Our Abpromise guarantee covers the use of ab159927 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • PRO 232
    • PRO232
    • Prostate stem cell antigen
  • Relevance
    PSCA (Prostate Stem Cell antigen) is a cell surface antigen, which is overexpressed in ~40% of primary prostate cancers and in as many as 100% of metastatic ones. PSCA is also overexpressed in a majority of transitional cell and pancreatic carcinomas. Antibody directed against PSCA inhibits tumorigenesis, slows tumor growth, prolongs survival and prevents metastasis in a preclinical zenograft model indicating that PSCA may have utility as a prognostic marker and/or therapeutic target in prostate cancer.
  • Cellular localization
    Cell membrane; Lipid-anchor, GPI-anchor.

Images

  • ab159927 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

This product has been referenced in:
  • Liu N  et al. Simultaneous and combined detection of multiple tumor biomarkers for prostate cancer in human serum by suspension array technology. Biosens Bioelectron 47:92-8 (2013). Read more (PubMed: 23567627) »

See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159927.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up