Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      QGKHCILDVSANAVRRLQAAHLHPIAIFIRPRSLENVLEINKRITEEQAR KAFDRATKLEQEFTECFSAIVEGDSFEEIYHKVKRVIEDLSGPYIWVPAR ER
    • Molecular weight
      37 kDa including tags
    • Amino acids
      665 to 766

Specifications

Our Abpromise guarantee covers the use of ab114158 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

    SDS-PAGE

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    ab is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Discs large homolog 4
    • Disks large homolog 4
    • DLG 4
    • Dlg4
    • DLG4_HUMAN
    • FLJ97752
    • FLJ98574
    • Human post synaptic density protein 95
    • Post synaptic density protein 95
    • Postsynaptic density protein 95
    • PSD 95
    • PSD-95
    • PSD95
    • SAP 90
    • SAP-90
    • SAP90
    • Synapse associated protein 90
    • Synapse-associated protein 90
    • Tax interaction protein 15
    see all
  • Function
    Interacts with the cytoplasmic tail of NMDA receptor subunits and shaker-type potassium channels. Required for synaptic plasticity associated with NMDA receptor signaling. Overexpression or depletion of DLG4 changes the ratio of excitatory to inhibitory synapses in hippocampal neurons. May reduce the amplitude of ASIC3 acid-evoked currents by retaining the channel intracellularly. May regulate the intracellular trafficking of ADR1B.
  • Tissue specificity
    Brain.
  • Sequence similarities
    Belongs to the MAGUK family.
    Contains 1 guanylate kinase-like domain.
    Contains 3 PDZ (DHR) domains.
    Contains 1 SH3 domain.
  • Domain
    The PDZ domain 3 mediates interaction with ADR1B.
    The L27 domain near the N-terminus of isoform 2 is required for HGS/HRS-dependent targeting to postsynaptic density.
  • Post-translational
    modifications
    Palmitoylation of isoform 1 is required for targeting to postsynaptic density.
  • Cellular localization
    Cell membrane. Cell junction, synapse, postsynaptic cell membrane, postsynaptic density. Cell projection, axon. Cell junction, synapse. High levels in postsynaptic density of neurons in the forebrain. Also in presynaptic region of inhibitory synapses formed by cerebellar basket cells on axon hillocks of Purkinje cells.
  • Information by UniProt

Recombinant Human PSD95 protein images

  • 12.5% SDS-PAGE analysis of ab114158, stained with Coomassie Blue.

References for Recombinant Human PSD95 protein (ab114158)

ab114158 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114158.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up