Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MGPLSAPPCTQHITWKGVLLTASLLNFWNLPITAQVTIEALPPKVSEGKD VLLLVHNLPQNLAGYIWYKGQLMDLYHYITSYVVDGQINIYGPAYTGRET VYSNASLLIQNVTREDAGSYTLHIIKRGDRTRGVTGYFTFNLYLKLPKPY ITINNSKPRENKDVLAFTCEPKSENYTYIWWLNGQSLPVSPRVKQPIENR ILILPSVTRNETGPYECEIRDRDGGMHSDPVTLNVLYGPDLPSIYPSFTY YRSGENLYLSCFAESNPPAEYFWTINGKFQQSGQKLSIPQITTKHRGLYT CSVRNSATGKESSKSMTVEVSAPSGIGRLPLLNPI
    • Amino acids
      1 to 335
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159254 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Fetal liver non specific cross reactive antigen 3
    • Fetal liver non-specific cross-reactive antigen 3
    • FL NCA 3
    • FL-NCA-3
    • Pregnancy specific beta 1 glycoprotein 5 [Precursor]
    • pregnancy specific beta-1-glycoprotein 5
    • pregnancy-specific beta 1 glycoprotein
    • Pregnancy-specific beta-1-glycoprotein 5
    • Pregnancy-specific glycoprotein 5
    • PS-beta-G-5
    • PSBG 5
    • PSBG-5
    • PSG
    • PSG5
    • PSG5_HUMAN
    see all
  • Tissue specificity
    Synthesized by syncytiotrophoblast of the placenta.
  • Sequence similarities
    Belongs to the immunoglobulin superfamily. CEA family.
    Contains 2 Ig-like C2-type (immunoglobulin-like) domains.
    Contains 1 Ig-like V-type (immunoglobulin-like) domain.
  • Developmental stage
    PSBG are produced in high quantity during pregnancy.
  • Cellular localization
    Secreted.
  • Information by UniProt

Images

  • ab159254 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159254 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159254.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up