Overview

  • Product name
    Recombinant Human PSG6 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MGPLSAPPCTQHITWKGLLLTASLLNFWNLPTTAQVIIEAKPPKVSEGKD VLLLVHNLPQNLTGYIWYKGQMTDLYHYITSYVVHGQIIYGPAYSGRETV YSNASLLIQNVTQEDAGSYTLHIIKRGDGTGGVTGYFTVTLYSETPKPSI SSSNLNPREVMEAVRLICDPETPDASYLWLLNGQNLPMTHRLQLSKTNRT LYLFGVTKYIAGPYECEIRNPVSASRSDPVTLNLLPKLPMPYITINNLNP REKKDVLAFTCEPKSRNYTYIWWLNGQSLPVSPRVKRPIENRILILPSVT RNETGPYQCEIRDRYGGIRSNPVTLNVLYGPDLPRIYPSFTYYRSGENLD LSCFADSNPPAEYSWTINGKFQLSGQKLFIPQITTNHSGLYACSVRNSAT GKEISKSMIVKVSGPCHGNQTESH
    • Amino acids
      1 to 424
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159255 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CGM3
    • Pregnancy specific beta 1 glycoprotein 6
    • Pregnancy-specific beta-1-glycoprotein 10
    • Pregnancy-specific beta-1-glycoprotein 12
    • Pregnancy-specific beta-1-glycoprotein 6
    • Pregnancy-specific glycoprotein 10
    • Pregnancy-specific glycoprotein 12
    • Pregnancy-specific glycoprotein 6
    • PS-beta-G-10
    • PS-beta-G-12
    • PS-beta-G-6
    • PSBG 6
    • PSBG-10
    • PSBG-12
    • PSBG-6
    • PSG10
    • PSG6
    • PSG6_HUMAN
    • PSGGB
    see all
  • Sequence similarities
    Belongs to the immunoglobulin superfamily. CEA family.
    Contains 3 Ig-like C2-type (immunoglobulin-like) domains.
    Contains 1 Ig-like V-type (immunoglobulin-like) domain.
  • Developmental stage
    PSBG are produced in high quantity during pregnancy.
  • Cellular localization
    Secreted.
  • Information by UniProt

Images

  • ab159255 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159255 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159255.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up