Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      EVTIEAQPPKVSEGKDVLLLVHNLPQNLPGYFWYKGEMTDLYHYIISYIV DGKIIIYGPAYSGRETVYSNASLLIQNVTRKDAGTYTLHIIKRGDETREE IRHFTFTLYLETPKPYISSSNLNPREAMEAVRLICDPETLDASYLWWMNG QSLPVTHRLQLSKTNRTLYLFGVTKYIAGPYECEIRNPVSASRSDPVTLN LLPKLPIPYITINNLNPRENKDVLAFTCEPKSENYTYIWWLNGQSLPVSP GVKRPIENRILILPSVTRNETGPYQCEIQDRYGGLRSNPVILNVLYGPDL PRIYPSFTYYRSGENLDLSCFTESNPPAEYFWTINGKFQQSGQKLFIPQI TRNHSGLYACSVHNSATGKEISKSMTVKVSGPCHGDLTESQS
    • Molecular weight
      69 kDa including tags
    • Amino acids
      35 to 426

Associated products

Specifications

Our Abpromise guarantee covers the use of ab116750 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml. Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names
    • pregnancy specific beta 1 glycoprotein (PSG)
    • pregnancy specific beta 1 glycoprotein 11
    • pregnancy specific beta 1 glycoprotein 9
    • pregnancy specific beta 1 glycoprotein B
    • Pregnancy-specific beta-1 glycoprotein B
    • Pregnancy-specific beta-1-glycoprotein 11
    • Pregnancy-specific beta-1-glycoprotein 9
    • Pregnancy-specific glycoprotein 11
    • Pregnancy-specific glycoprotein 7
    • Pregnancy-specific glycoprotein 9
    • PS beta B
    • PS-beta-B
    • PS-beta-G-11
    • PS-beta-G-9
    • PS34
    • PSBG 9
    • PSBG-11
    • PSBG-9
    • PSG 9
    • PSG11
    • PSG7
    • PSG9
    • PSG9_HUMAN
    • PSGII
    see all
  • Sequence similarities
    Belongs to the immunoglobulin superfamily. CEA family.
    Contains 3 Ig-like C2-type (immunoglobulin-like) domains.
    Contains 1 Ig-like V-type (immunoglobulin-like) domain.
  • Developmental stage
    PSBG are produced in high quantity during pregnancy.
  • Cellular localization
    Secreted.
  • Information by UniProt

Recombinant Human PSG9 protein images

  • 12.5% SDS-PAGE analysis of ab116750 at approximately 69.23kDa stained with Coomassie Blue.

References for Recombinant Human PSG9 protein (ab116750)

ab116750 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116750.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up