Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ00887
    • SpeciesHuman
    • SequenceEVTIEAQPPKVSEGKDVLLLVHNLPQNLPGYFWYKGEMTDLYHYIISYIV DGKIIIYGPAYSGRETVYSNASLLIQNVTRKDAGTYTLHIIKRGDETREE IRHFTFTLYLETPKPYISSSNLNPREAMEAVRLICDPETLDASYLWWMNG QSLPVTHRLQLSKTNRTLYLFGVTKYIAGPYECEIRNPVSASRSDPVTLN LLPKLPIPYITINNLNPRENKDVLAFTCEPKSENYTYIWWLNGQSLPVSP GVKRPIENRILILPSVTRNETGPYQCEIQDRYGGLRSNPVILNVLYGPDL PRIYPSFTYYRSGENLDLSCFTESNPPAEYFWTINGKFQQSGQKLFIPQI TRNHSGLYACSVHNSATGKEISKSMTVKVSGPCHGDLTESQS
    • Molecular weight69 kDa including tags
    • Amino acids35 to 426

Specifications

Our Abpromise guarantee covers the use of ab116750 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    ELISA

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml. Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names
    • pregnancy specific beta 1 glycoprotein (PSG)
    • pregnancy specific beta 1 glycoprotein 11
    • pregnancy specific beta 1 glycoprotein 9
    • pregnancy specific beta 1 glycoprotein B
    • Pregnancy-specific beta-1 glycoprotein B
    • Pregnancy-specific beta-1-glycoprotein 11
    • Pregnancy-specific beta-1-glycoprotein 9
    • Pregnancy-specific glycoprotein 11
    • Pregnancy-specific glycoprotein 7
    • Pregnancy-specific glycoprotein 9
    • PS beta B
    • PS-beta-B
    • PS-beta-G-11
    • PS-beta-G-9
    • PS34
    • PSBG 9
    • PSBG-11
    • PSBG-9
    • PSG 9
    • PSG11
    • PSG7
    • PSG9
    • PSG9_HUMAN
    • PSGII
    see all
  • Sequence similaritiesBelongs to the immunoglobulin superfamily. CEA family.
    Contains 3 Ig-like C2-type (immunoglobulin-like) domains.
    Contains 1 Ig-like V-type (immunoglobulin-like) domain.
  • Developmental stagePSBG are produced in high quantity during pregnancy.
  • Cellular localizationSecreted.
  • Information by UniProt

Recombinant Human PSG9 protein images

  • 12.5% SDS-PAGE analysis of ab116750 at approximately 69.23kDa stained with Coomassie Blue.

References for Recombinant Human PSG9 protein (ab116750)

ab116750 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116750.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"