Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionO14818
    • SpeciesHuman
    • SequenceMSYDRAITVFSPDGHLFQVEYAQEAVKKGSTAVGVRGRDIVVLGVEKKSV AKLQDERTVR KICALDDNVCMAFAGLTADARIVINRARVECQSHRLTV EDPVTVEYITRYIASLKQRYTQ SNGRRPFGISALIVGFDFDGTPRLYQ TDPSGTYHAWKANAIGRGAKSVREFLEKNYTDEA IETDDLTIKLVIKA LLEVVQSGGKNIELAVMRRDQSLKILNPEEIEKYVAEIEKEKEENE KK KQKKAS
    • Molecular weight30 kDa including tags
    • Amino acids1 to 248

Associated products

Specifications

Our Abpromise guarantee covers the use of ab81381 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity> 90 % SDS-PAGE.
    Purified by using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 20% Glycerol, 20mM Tris HCl, 100mM Sodium chloride, pH 8.0

General Info

  • Alternative names
    • C6
    • HSPC
    • MGC3755
    • OTTHUMP00000031449
    • OTTHUMP00000031450
    • OTTHUMP00000031453
    • Proteasome (prosome macropain) subunit alpha type 7
    • Proteasome alpha 7 subunit
    • Proteasome subunit alpha 4
    • Proteasome subunit alpha type 7
    • Proteasome subunit alpha type-7
    • Proteasome subunit RC6 1
    • Proteasome subunit RC6-1
    • Proteasome subunit XAPC7
    • PSA7_HUMAN
    • PSMA 7
    • PSMA7
    • RC6 1
    • XAPC7
    see all
  • FunctionThe proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity. Plays an important role in the regulation of cell proliferation or cell cycle control, transcriptional regulation, immune and stress response, cell differentiation, and apoptosis. Interacts with some important proteins involved in transcription factor regulation, cell cycle transition, viral replication and even tumor initiation and progression. Inhibits the transactivation function of HIF-1A under both normoxic and hypoxia-mimicking conditions. The interaction with EMAP2 increases the proteasome-mediated HIF-1A degradation under the hypoxic conditions. Plays a role in hepatitis C virus internal ribosome entry site-mediated translation. Mediates nuclear translocation of the androgen receptor (AR) and thereby enhances androgen-mediated transactivation. Promotes MAVS degradation and thereby negatively regulates MAVS-mediated innate immune response.
  • Sequence similaritiesBelongs to the peptidase T1A family.
  • Post-translational
    modifications
    Phosphorylation by ABL1 or ABL2 leads to an inhibition of proteasomal activity and cell cycle transition blocks.
  • Cellular localizationCytoplasm. Nucleus.
  • Information by UniProt

Recombinant Human PSMA7 protein images

  • SDS-PAGE analysis of 3µg ab81381 on 15% gel.

References for Recombinant Human PSMA7 protein (ab81381)

ab81381 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab81381.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"