Recombinant Human PSMB10 protein (ab113577)

Overview

  • Product name
    Recombinant Human PSMB10 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMTTIAGLVFQDGVILGADTRATNDSVVADK SCEKIHFIAPKIYCCGAGVAADAEMTTRMVASKMELHALSTGREPRVATV TRILRQTLFRYQGHVGASLIVGGVDLTGPQLYGVHPHGSYSRLPFTALGS GQDAALAVLEDRFQPNMTLEAAQGLLVEAVTAGILGDLGSGGNVDACVIT KTGAKLLRTLSSPTEPVKRSGRYHFVPGTTAVLTQTVKPLTLELVEETVQ AMEVE
    • Molecular weight
      27 kDa including tags
    • Amino acids
      40 to 237
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab113577 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 90 % SDS-PAGE.
    ab113577 is purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.02% Tris HCl, 40% Glycerol, 0.58% Sodium chloride

General Info

  • Alternative names
    • beta2i
    • FLJ00366
    • LMP10
    • Low molecular mass protein 10
    • Macropain subunit MECl 1
    • Macropain subunit MECl-1
    • MECL1
    • MGC1665
    • Multicatalytic endopeptidase complex subunit MECl 1
    • Multicatalytic endopeptidase complex subunit MECl-1
    • OTTHUMP00000174858
    • Proteasome (prosome macropain) subunit beta type 10
    • Proteasome beta 10 subunit
    • Proteasome catalytic subunit 2i
    • Proteasome MECl 1
    • Proteasome MECl-1
    • Proteasome subunit beta 2i
    • Proteasome subunit beta 7i
    • Proteasome subunit beta type 10
    • Proteasome subunit beta type-10
    • Proteasome subunit beta-2i
    • Proteasome subunit MECL1
    • PSB10_HUMAN
    • PSMB 10
    • Psmb10
    see all
  • Function
    The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity. This subunit is involved in antigen processing to generate class I binding peptides.
  • Sequence similarities
    Belongs to the peptidase T1B family.
  • Developmental stage
    Highly expressed in immature dendritic cells (at protein level).
  • Post-translational
    modifications
    Autocleaved. The resulting N-terminal Thr residue of the mature subunit is responsible for the nucleophile proteolytic activity.
  • Cellular localization
    Cytoplasm. Nucleus.
  • Information by UniProt

Recombinant Human PSMB10 protein images

  • 15% SDS-PAGE showing ab113577 at approximately 26.9kDa (3µg).

References for Recombinant Human PSMB10 protein (ab113577)

ab113577 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab113577.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up