Overview

  • Product name
    Recombinant Human PSMB5 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSMTTTLAFKFRHGVI VAADSRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQC RIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYY VDSEGNRISGATFSVGSGSVYAYGVMDRGYSYDLEVEQAYDLARRAIYQA TYRDAYSGGAVNLYHVREDGWIRVSSDNVADLHEKYSGSTP
    • Molecular weight
      27 kDa including tags
    • Amino acids
      60 to 263
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab101825 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 90 % SDS-PAGE.
    ab101825 was purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.5
    Constituents: 0.015% DTT, 0.316% Tris HCl, 50% Glycerol, 0.876% Sodium chloride

General Info

  • Alternative names
    • DKFZp459C139
    • EC 3.4.25.1
    • LMPX
    • Macropain epsilon chain
    • MB1
    • MGC104214
    • MGC118075
    • MGC134464
    • Multicatalytic endopeptidase complex epsilon chain
    • Proteasome (prosome, macropain) subunit, beta type, 5
    • Proteasome beta 5 subunit
    • Proteasome catalytic subunit 3
    • Proteasome chain 6
    • Proteasome epsilon chain
    • Proteasome subunit beta type-5
    • Proteasome subunit MB1
    • Proteasome subunit X
    • Proteasome subunit, beta type, 5
    • Proteasome subunit, beta-5
    • PSB5_HUMAN
    • PSMB5
    • PSX large multifunctional protease X
    • X
    see all
  • Function
    The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity. This unit is responsible of the chymotrypsin-like activity of the proteasome and is one of the principal target of the proteasome inhibitor bortezomib. May catalyze basal processing of intracellular antigens. Plays a role in the protection against oxidative damage throught the Nrf2-ARE pathway.
  • Sequence similarities
    Belongs to the peptidase T1B family.
  • Cellular localization
    Cytoplasm. Nucleus.
  • Information by UniProt

Recombinant Human PSMB5 protein images

  • 15% SDS-PAGE analysis of ab101825 (3µg)

References for Recombinant Human PSMB5 protein (ab101825)

ab101825 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab101825.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up