Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP17980
    • SpeciesHuman
    • SequenceMNLLPNIESPVTRQEKMATVWDEAEQDGIGEEVLKMSTEEIIQRTRLLDS EIKIMKSEVLRVTHELQAMKDKIKENSEKIKVNKTLPYLVSNVIELLDVD
    • Molecular weight37 kDa including tags
    • Amino acids53 to 152

Associated products

Specifications

Our Abpromise guarantee covers the use of ab116966 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 26S protease regulatory subunit 6A
    • 26S proteasome AAA-ATPase subunit RPT5
    • Human immunodeficiency virus tat transactivator binding protein 1
    • MGC8487
    • Proteasome (prosome macropain) 26S subunit ATPase 3
    • Proteasome 26S ATPase subunit 3
    • Proteasome 26S subunit ATPase 3
    • Proteasome subunit P50
    • PRS6A_HUMAN
    • PSMC 3
    • PSMC3
    • Tat binding protein 1
    • TAT-binding protein 1
    • TBP-1
    • TBP1
    see all
  • FunctionThe 26S protease is involved in the ATP-dependent degradation of ubiquitinated proteins. The regulatory (or ATPase) complex confers ATP dependency and substrate specificity to the 26S complex (By similarity). In case of HIV-1 infection, suppresses Tat-mediated transactivation.
  • Sequence similaritiesBelongs to the AAA ATPase family.
  • Post-translational
    modifications
    Sumoylated by UBE2I in response to MEKK1-mediated stimuli.
  • Cellular localizationCytoplasm. Nucleus.
  • Information by UniProt

Recombinant Human PSMC3 protein images

  • 12.5% SDS-PAGE showing ab116966 at approximately 36.63kDa stained with Coomassie Blue.

References for Recombinant Human PSMC3 protein (ab116966)

ab116966 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116966.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"