Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MNLLPNIESPVTRQEKMATVWDEAEQDGIGEEVLKMSTEEIIQRTRLLDS EIKIMKSEVLRVTHELQAMKDKIKENSEKIKVNKTLPYLVSNVIELLDVD
    • Molecular weight
      37 kDa including tags
    • Amino acids
      53 to 152

Specifications

Our Abpromise guarantee covers the use of ab116966 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 26S protease regulatory subunit 6A
    • 26S proteasome AAA-ATPase subunit RPT5
    • Human immunodeficiency virus tat transactivator binding protein 1
    • MGC8487
    • Proteasome (prosome macropain) 26S subunit ATPase 3
    • Proteasome 26S ATPase subunit 3
    • Proteasome 26S subunit ATPase 3
    • Proteasome subunit P50
    • PRS6A_HUMAN
    • PSMC 3
    • PSMC3
    • Tat binding protein 1
    • TAT-binding protein 1
    • TBP-1
    • TBP1
    see all
  • Function
    The 26S protease is involved in the ATP-dependent degradation of ubiquitinated proteins. The regulatory (or ATPase) complex confers ATP dependency and substrate specificity to the 26S complex (By similarity). In case of HIV-1 infection, suppresses Tat-mediated transactivation.
  • Sequence similarities
    Belongs to the AAA ATPase family.
  • Post-translational
    modifications
    Sumoylated by UBE2I in response to MEKK1-mediated stimuli.
  • Cellular localization
    Cytoplasm. Nucleus.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE showing ab116966 at approximately 36.63kDa stained with Coomassie Blue.

References

ab116966 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab116966.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up