Recombinant Human PSMD11 protein (ab159269)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAAAAVVEFQRAQSLLSTDREASIDILHSIVKRDIQENDEEAVQVKEQSI LELGSLLAKTGQAAELGGLLKYVRPFLNSISKAKAARLVRSLLDLFLDME AATGQEVELCLECIEWAKSEKRTFLRQALEARLVSLYFDTKRYQEALHLG SQLLRELKKMDDKALLVEVQLLESKTYHALSNLPKARAALTSARTTANAI YCPPKLQATLDMQSGIIHAAEEKDWKTAYSYFYEAFEGYDSIDSPKAITS LKYMLLCKIMLNTPEDVQALVSGKLALRYAGRQTEALKCVAQASKNRSLA DFEKALTDYRAELRDDPIISTHLAKLYDNLLEQNLIRVIEPFSRVQIEHI SSLIKLSKADVERKLSQMILDKKFHGILDQGEGVLIIFDEPPVDKTYEAA LETIQNMSKVVDSLYNKAKKLT
    • Amino acids
      1 to 422
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159269 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 26S proteasome non-ATPase regulatory subunit 11
    • 26S proteasome regulatory subunit 9
    • 26S proteasome regulatory subunit p44.5
    • 26S proteasome regulatory subunit RPN6
    • 26S proteasome regulatory subunit S9
    • MGC3844
    • p44.5
    • protease 26S, subunit, 9
    • proteasome (prosome, macropain) 26S subunit, non-ATPase, 11
    • proteasome 26S subunit, non-ATPase, 11
    • PSD11_HUMAN
    • PSMD 11
    • PSMD11
    • Rpn6
    • S9
    see all
  • Function
    Component of the lid subcomplex of the 26S proteasome, a multiprotein complex involved in the ATP-dependent degradation of ubiquitinated proteins. In the complex, PSMD11 is required for proteasome assembly. Plays a key role in increased proteasome activity in embryonic stem cells (ESCs): its high expression in ESCs promotes enhanced assembly of the 26S proteasome, followed by higher proteasome activity.
  • Tissue specificity
    Highly expressed in embryonic stem cells (ESCs). Expression decreases as ESCs differentiate.
  • Sequence similarities
    Belongs to the proteasome subunit S9 family.
    Contains 1 PCI domain.
  • Post-translational
    modifications
    Phosphorylated by AMPK.
  • Cellular localization
    Nucleus. Cytoplasm > cytosol.
  • Information by UniProt

Images

  • ab159269 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159269 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159269.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up