Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MYEQLKGEWNRKSPNLSKCGEELGRLKLVLLELNFLPTTGTKLTKQQLIL ARDILEIGAQWSILRKDIPSFERYMAQLKCYYFDYKEQLPESAYMHQLLG LNLLFLLSQNRVAEFHTELERLPAKDIQTNVYIKHPVSLEQYLMEGSYNK VFLAKGNIPAESYTFFIDILLDTIRDEIAGCIEKAYEKILFTEATRILFF NTPKKMTDYAKKRGWVLGPNNYYSFASQQQKPEDTTIPSTELAKQVIEYA RQLEMIV
    • Molecular weight
      54 kDa including tags
    • Amino acids
      1 to 257

Specifications

Our Abpromise guarantee covers the use of ab116973 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 26S proteasome non ATPase regulatory subunit 8
    • 26S proteasome non-ATPase regulatory subunit 8
    • 26S proteasome regulatory subunit p31
    • 26S proteasome regulatory subunit RPN12
    • 26S proteasome regulatory subunit S14
    • AAV38494
    • HIP6
    • HYPF
    • MGC1660
    • Nin1p
    • P31
    • Proteasome (prosome macropain) 26S subunit non ATPase 8
    • PSMD8
    • PSMD8_HUMAN
    • Rpn12
    • S14
    see all
  • Function
    Acts as a regulatory subunit of the 26S proteasome which is involved in the ATP-dependent degradation of ubiquitinated proteins. Necessary for activation of the CDC28 kinase.
  • Sequence similarities
    Belongs to the proteasome subunit S14 family.
  • Information by UniProt

Recombinant Human PSMD8 protein images

  • 12.5% SDS-PAGE showing ab116973 at approximately 54.27kDa.
    Stained with Coomassie Blue.

References for Recombinant Human PSMD8 protein (ab116973)

ab116973 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116973.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up