Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MYEQLKGEWNRKSPNLSKCGEELGRLKLVLLELNFLPTTGTKLTKQQLIL ARDILEIGAQWSILRKDIPSFERYMAQLKCYYFDYKEQLPESAYMHQLLG LNLLFLLSQNRVAEFHTELERLPAKDIQTNVYIKHPVSLEQYLMEGSYNK VFLAKGNIPAESYTFFIDILLDTIRDEIAGCIEKAYEKILFTEATRILFF NTPKKMTDYAKKRGWVLGPNNYYSFASQQQKPEDTTIPSTELAKQVIEYA RQLEMIV
    • Molecular weight
      54 kDa including tags
    • Amino acids
      1 to 257

Specifications

Our Abpromise guarantee covers the use of ab116973 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 26S proteasome non ATPase regulatory subunit 8
    • 26S proteasome non-ATPase regulatory subunit 8
    • 26S proteasome regulatory subunit p31
    • 26S proteasome regulatory subunit RPN12
    • 26S proteasome regulatory subunit S14
    • AAV38494
    • HIP6
    • HYPF
    • MGC1660
    • Nin1p
    • P31
    • Proteasome (prosome macropain) 26S subunit non ATPase 8
    • PSMD8
    • PSMD8_HUMAN
    • Rpn12
    • S14
    see all
  • Function
    Acts as a regulatory subunit of the 26S proteasome which is involved in the ATP-dependent degradation of ubiquitinated proteins. Necessary for activation of the CDC28 kinase.
  • Sequence similarities
    Belongs to the proteasome subunit S14 family.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE showing ab116973 at approximately 54.27kDa.
    Stained with Coomassie Blue.

References

ab116973 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab116973.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up