Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMAMLRVQPEAQAKVDVFREDLCTKTENLLG SYFPKKISELDAFLKEPALNEANLSNLKAPLDIPVPDPVKEKEKEERKKQ QEKEDKDEKKKGEDEDKGPPCGPVNCNEKIVVLLQRLKPEIKDVIEQLNL VTTWLQLQIPRIEDGNNFGVAVQEKVFELMTSLHTKLEGFHTQISKYFSE RGDAVTKAAKQPHVGDYRQLVHELDEAEYRDIRLMVMEIRNAYAVLYDII LKNFEKLKKPRGETKGMIY
    • Molecular weight
      31 kDa including tags
    • Amino acids
      1 to 249
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab99961 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 90 % SDS-PAGE.
    ab99961 is purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, pH 8.0

General Info

  • Alternative names
    • 11S regulator complex alpha subunit
    • 11S regulator complex subunit alpha
    • 29 kD MCP activator subunit
    • 29kD MCP activator subunit
    • Activator of multicatalytic protease subunit 1
    • IFI5111
    • IGUP I-5111
    • Interferon gamma IEF SSP 5111
    • Interferon gamma inducible protein 5111
    • Interferon gamma up regulated I 5111 protein
    • Interferon gamma up-regulated I-5111 protein
    • MGC8628
    • PA28a
    • PA28alpha
    • Proteasome (prosome, macropain) activator subunit 1 (PA28 alpha)
    • Proteasome activator 28 subunit alpha
    • Proteasome activator complex subunit 1
    • Proteasome activator subunit 1
    • PSME1
    • PSME1_HUMAN
    • REG-alpha
    • REGalpha
    see all
  • Function
    Implicated in immunoproteasome assembly and required for efficient antigen processing. The PA28 activator complex enhances the generation of class I binding peptides by altering the cleavage pattern of the proteasome.
  • Sequence similarities
    Belongs to the PA28 family.
  • Information by UniProt

Recombinant Human PSME1 protein images

  • 15% SDS-PAGE showing ab99961 (3 µg) at approximately 30.8 kDa.

References for Recombinant Human PSME1 protein (ab99961)

ab99961 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab99961.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up