Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionQ9UL46
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMAKPCGVRLSGEARKQVEVFRQNLFQEAEE FLYRFLPQKIIYLNQLLQEDSLNVADLTSLRAPLDIPIPDPPPKDDEMET DKQEKKEVPKCGFLPGNEKVLSLLALVKPEVWTLKEKCILVITWIQHLIP KIEDGNDFGVAIQEKVLERVNAVKTKVEAFQTTISKYFSERGDAVAKASK ETHVMDYRALVHERDEAAYGELRAMVLDLRAFYAELYHIISSNLEKIVNP KGEEKPSMY
    • Molecular weight30 kDa including tags
    • Amino acids1 to 239
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab117228 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry
    MALDI-TOF
  • Purity> 95 % SDS-PAGE.
    ab117228 is purified using conventional chromatography.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 20% Glycerol, 0.58% Sodium chloride, 0.02% DTT, 0.002% PMSF

General Info

  • Alternative names
    • 11S regulator complex beta subunit
    • 11S regulator complex subunit beta
    • Activator of multicatalytic protease subunit 2
    • Cell migration inducing protein 22
    • MCP activator 31 kD subunit
    • PA28 beta
    • PA28b
    • PA28beta
    • Proteasome (prosome macropain) activator subunit 2
    • Proteasome (prosome macropain) activator subunit 2 (PA28 beta)
    • Proteasome activator 28 beta
    • Proteasome activator 28 subunit beta
    • Proteasome activator complex subunit 2
    • Proteasome activator hPA28 subunit beta
    • Proteasome activator subunit 2
    • PSME 2
    • PSME2
    • PSME2_HUMAN
    • REG beta
    • REG-beta
    • REGbeta
    see all
  • FunctionImplicated in immunoproteasome assembly and required for efficient antigen processing. The PA28 activator complex enhances the generation of class I binding peptides by altering the cleavage pattern of the proteasome.
  • Sequence similaritiesBelongs to the PA28 family.
  • Information by UniProt

Recombinant Human PSME2 protein images

  • 15% SDS-PAGE showing ab117228 at approximately 29.5kDa (3µg).

References for Recombinant Human PSME2 protein (ab117228)

ab117228 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab117228.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"