Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMASLLKVDQEVKLKVDSFRERITSEAEDLV ANFFPKKLLELDSFLKEPILNIHDLTQIHSDMNLPVPDPILLTNSHDGLD GPTYKKRRLDECEEAFQGTKVFVMPNGMLKSNQQLVDIIEKVKPEIRLLI EKCNTVKMWVQLLIPRIEDGNNFGVSIQEETVAELRTVESEAASYLDQIS RYYITRAKLVSKIAKYPHVEDYRRTVTEIDEKEYISLRLIISELRNQYVT LHDMILKNIEKIKRPRSSNAETLY
    • Molecular weight
      32 kDa including tags
    • Amino acids
      1 to 254
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab115714 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 90 % SDS-PAGE.
    ab115714 was purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 0.03% DTT, 40% Glycerol, 1.17% Sodium chloride

General Info

  • Alternative names
    • 11S regulator complex gamma subunit
    • 11S regulator complex subunit gamma
    • Activator of multicatalytic protease subunit 3
    • Ki
    • Ki antigen
    • Ki nuclear autoantigen
    • Ki, PA28 gamma
    • PA28 gamma
    • PA28g
    • PA28gamma
    • Proteasome (prosome, macropain) activator subunit 3
    • Proteasome (prosome, macropain) activator subunit 3 (PA28 gamma; Ki)
    • Proteasome activator 28 gamma
    • Proteasome activator 28 subunit gamma
    • Proteasome activator complex subunit 3
    • Proteasome activator subunit 3
    • PSME3
    • PSME3_HUMAN
    • REG GAMMA
    • REG-gamma
    see all
  • Function
    Subunit of the 11S REG-gamma (also called PA28-gamma) proteasome regulator, a donut-shaped homoheptamer which associates with the proteasome. 11S REG-gamma activates the trypsin-like catalytic subunit of the proteasome but inhibits the chymotrypsin-like and postglutamyl-preferring (PGPH) subunits. Facilitates the MDM2-p53/TP53 interaction which promotes ubiquitination- and MDM2-dependent proteasomal degradation of p53/TP53, limiting its accumulation and resulting in inhibited apoptosis after DNA damage. May also be involved in cell cycle regulation.
  • Sequence similarities
    Belongs to the PA28 family.
  • Domain
    The C-terminal sequences affect heptamer stability and proteasome affinity.
  • Post-translational
    modifications
    Phosphorylated by MAP3K3.
  • Cellular localization
    Nucleus. Cytoplasm. Localizes to the cytoplasm during mitosis following nuclear envelope breakdown at this distinct stage of the cell cycle which allows its interaction with MAP3K3 kinase.
  • Information by UniProt

Images

  • 15% SDS-PAGE showing ab115714 (3µg).

References

ab115714 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab115714.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up