Overview

  • Product name
    Recombinant Human PSMG1 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAATFFGEVVKAPCRAGTEDEEEEEEGRRETPEDREVRLQLARKREVRLL RRQTKTSLEVSLLEKYPCSKFIIAIGNNAVAFLSSFVMNSGVWEEVGCAK LWNEWCRTTDTTHLSSTEAFCVFYHLKSNPSVFLCQCSCYVAEDQQYQWL EKVFGSCPRKNMQITILTCRHVTDYKTSESTGSLPSPFLRALKTQNFKDS ACCPLLEQPNIVHDLPAAVLSYCQVWKIPAILYLCYTDVMKLDLITVEAF KPILSTRSLKGLVKNIPQSTEILKKLMTTNEIQSNIYT
    • Amino acids
      1 to 288
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160117 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • AW552102
    • c21 LRP
    • C21LRP
    • Chromosome 21 leucine rich protein
    • Down syndrome critical region gene 2
    • Down syndrome critical region protein 2
    • Down syndrome critical region protein 2 homolog
    • DSCR2
    • leucine rich protein C21 LRP
    • LRPC21
    • PAC-1
    • PAC1
    • proteasome (prosome, macropain) assembly chaperone 1
    • proteasome assembling chaperone 1
    • Proteasome assembly chaperone 1
    see all
  • Relevance
    PSMG1 is a chaperone protein which promotes assembly of the 20S proteasome as part of a heterodimer with PSMG2. The PSMG1-PSMG2 heterodimer binds to the PSMA5 and PSMA7 proteasome subunits, promotes assembly of the proteasome alpha subunits into the heteroheptameric alpha ring and prevents alpha ring dimerization. There are two named isoforms.
  • Cellular localization
    Cytoplasm. Endoplasmic reticulum.

Images

  • ab160117 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160117 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160117.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up