Overview

  • Product nameRecombinant Human PSMG3 protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionQ9BT73
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMEDTPLVISKQKTEVVCGVPTQVVCTAFSS HILVVVTQFGKMGTLVSLEPSSVASDVSKPVLTTKVLLGQDEPLIHVFAK NLVAFVSQEAGNRAVLLAVAVKDKSMEGLKALREVIRVCQVW
    • Molecular weight15 kDa including tags
    • Amino acids1 to 122
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab99521 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry
    MALDI-TOF
  • Purity> 90 % SDS-PAGE.
    ab99521 was purified using conventional chromatography.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Glycerol, 20mM Tris HCl, pH 8.0

General Info

  • Alternative names
    • C7orf48
    • hPAC3
    • MGC10911
    • PAC 3
    • PAC-3
    • PAC3
    • Proteasome (prosome macropain) assembly chaperone 3
    • Proteasome assembly chaperone 3
    • PSMG 3
    • PSMG3
    • PSMG3_HUMAN
    see all
  • FunctionChaperone protein which promotes assembly of the 20S proteasome. May cooperate with PSMG1-PSMG2 heterodimers to orchestrate the correct assembly of proteasomes.
  • Sequence similaritiesBelongs to the PSMG3 family.
  • Information by UniProt

Recombinant Human PSMG3 protein images

  • 15% SDS-PAGE analysis of 3µg ab99521.

References for Recombinant Human PSMG3 protein (ab99521)

ab99521 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab99521.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"