Overview

  • Product nameRecombinant Human PSMG4 protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionQ5JS54
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMEGLVVAAGGDVSLHNFSARLWEQLVHFHV MRLTDSLFLWVGATPHLRNLAVAMCSRYDSIPVSTSLLGDTSDTTSTGLA QRLARKTNKQVFVSYNLQNTDSNFALLVENRIKEEMEAFPEKF
    • Molecular weight16 kDa including tags
    • Amino acids1 to 123
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab117216 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry
    MALDI-TOF
  • Purity> 95 % SDS-PAGE.
    ab117216 was purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 0.02% DTT, 10% Glycerol, 0.58% Sodium chloride

General Info

  • Alternative names
    • C6orf86
    • hPAC4
    • PAC-4
    • PAC4
    • Proteasome assembly chaperone 4
    • Psmg4
    • PSMG4_HUMAN
    see all
  • FunctionChaperone protein which promotes assembly of the 20S proteasome.
  • Sequence similaritiesBelongs to the PSMG4 family.
  • Information by UniProt

Recombinant Human PSMG4 protein images

  • 15% SDS-PAGE analysis of ab117216 (3µg)

References for Recombinant Human PSMG4 protein (ab117216)

ab117216 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab117216.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"