Recombinant Human Psoriasin protein (ab104361)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MKHHHHHHASNTQAERSIIGMIDMFHKYTRRDDKIDKPSLLTM MKENF PNFLSACDKKGTNYLADVFEKKDKNEDKKIDFSEFLSLLGDIATD YHK QSHGAAPCSGGSQ
    • Molecular weight
      12 kDa
    • Amino acids
      2 to 101
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab104361 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form
    Lyophilised
  • Additional notes
    Product is not sterile! Please filter the product by an appropriate sterile filter before using it in the cell culture.
    Store lyophilized protein at –20°C. Lyophilized protein remains stable until the expiry date when stored at –20°C. Aliquot reconstituted protein to avoid repeated freezing/thawing cycles and store at –80°C for long term storage. Reconstituted protein can be stored at 4°C for a limited period of time; it does not show any change after one week at 4°C.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -80°C.

    Preservative: None
    Constituents: 20mM Tris, 100mM Sodium chloride, pH 7.5

  • Reconstitution
    Add deionized water to prepare a working stock solution of approximately 0.5 mg/ml and let the lyophilized pellet dissolve completely.

General Info

  • Alternative names
    • HID 5
    • Protein S100 A7
    • Protein S100-A7
    • PSOR 1
    • PSOR1
    • Psoriasin
    • Psoriasin 1
    • Psoriasin1
    • S100 Calcium binding protein A7
    • S100 calcium-binding protein A7
    • S100A7
    • S100A7c
    • S10A7_HUMAN
    see all
  • Tissue specificity
    Fetal ear, skin, and tongue and human cell lines. Highly up-regulated in psoriatic epidermis. Also highly expressed in the urine of bladder squamous cell carcinoma (SCC) bearing patients.
  • Sequence similarities
    Belongs to the S-101 family.
    Contains 2 EF-hand domains.
  • Cellular localization
    Cytoplasm. Secreted. Secreted by a non-classical secretory pathway.
  • Information by UniProt

Recombinant Human Psoriasin protein images

  • 14% SDS-PAGE showing ab104361 at approximately 12.48kDa:
    Lane 1: M.W. marker – 14, 21, 31, 45, 66, 97 kDa
    Lane 2: reduced and boiled sample, 5µg/lane.
    Lane 3: non-reduced and non-boiled sample, 5µg/lane.

References for Recombinant Human Psoriasin protein (ab104361)

ab104361 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab104361.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up