Recombinant Human Psoriasin protein (ab104361)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MKHHHHHHASNTQAERSIIGMIDMFHKYTRRDDKIDKPSLLTM MKENF PNFLSACDKKGTNYLADVFEKKDKNEDKKIDFSEFLSLLGDIATD YHK QSHGAAPCSGGSQ
    • Molecular weight
      12 kDa
    • Amino acids
      2 to 101
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab104361 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form
    Lyophilised
  • Additional notes
    Product is not sterile! Please filter the product by an appropriate sterile filter before using it in the cell culture.
    Store lyophilized protein at –20°C. Lyophilized protein remains stable until the expiry date when stored at –20°C. Aliquot reconstituted protein to avoid repeated freezing/thawing cycles and store at –80°C for long term storage. Reconstituted protein can be stored at 4°C for a limited period of time; it does not show any change after one week at 4°C.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -80°C.

    Preservative: None
    Constituents: 20mM Tris, 100mM Sodium chloride, pH 7.5

  • Reconstitution
    Add deionized water to prepare a working stock solution of approximately 0.5 mg/ml and let the lyophilized pellet dissolve completely.

General Info

  • Alternative names
    • HID 5
    • Protein S100 A7
    • Protein S100-A7
    • PSOR 1
    • PSOR1
    • Psoriasin
    • Psoriasin 1
    • Psoriasin1
    • S100 Calcium binding protein A7
    • S100 calcium-binding protein A7
    • S100A7
    • S100A7c
    • S10A7_HUMAN
    see all
  • Tissue specificity
    Fetal ear, skin, and tongue and human cell lines. Highly up-regulated in psoriatic epidermis. Also highly expressed in the urine of bladder squamous cell carcinoma (SCC) bearing patients.
  • Sequence similarities
    Belongs to the S-101 family.
    Contains 2 EF-hand domains.
  • Cellular localization
    Cytoplasm. Secreted. Secreted by a non-classical secretory pathway.
  • Information by UniProt

Images

  • 14% SDS-PAGE showing ab104361 at approximately 12.48kDa:
    Lane 1: M.W. marker – 14, 21, 31, 45, 66, 97 kDa
    Lane 2: reduced and boiled sample, 5µg/lane.
    Lane 3: non-reduced and non-boiled sample, 5µg/lane.

References

ab104361 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab104361.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up