Recombinant Human Psoriasin protein (ab105577)

Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionP31151
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMSNTQAERSIIGMIDMFHKYTRRDDKIDKP SLLTMMKENFPNFLSACDKKGTNYLADVFEKKDKNEDKKIDFSEFLSLLG DIATDYHKQSHGAAPCSGGSQ
    • Molecular weight14 kDa including tags
    • Amino acids1 to 101
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab105577 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 90 % SDS-PAGE.
    ab105577 was purified using conventional chromatography.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: 30% Glycerol, 20mM Tris HCl, 100mM Sodium chloride, 1mM DTT, pH 8

General Info

  • Alternative names
    • HID 5
    • Protein S100 A7
    • Protein S100-A7
    • PSOR 1
    • PSOR1
    • Psoriasin
    • Psoriasin 1
    • Psoriasin1
    • S100 Calcium binding protein A7
    • S100 calcium-binding protein A7
    • S100A7
    • S100A7c
    • S10A7_HUMAN
    see all
  • Tissue specificityFetal ear, skin, and tongue and human cell lines. Highly up-regulated in psoriatic epidermis. Also highly expressed in the urine of bladder squamous cell carcinoma (SCC) bearing patients.
  • Sequence similaritiesBelongs to the S-101 family.
    Contains 2 EF-hand domains.
  • Cellular localizationCytoplasm. Secreted. Secreted by a non-classical secretory pathway.
  • Information by UniProt

Recombinant Human Psoriasin protein images

  • 15% SDS-PAGE analysis of ab105577 (3ug)

References for Recombinant Human Psoriasin protein (ab105577)

ab105577 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab105577.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"