Overview

  • Product name
    Recombinant Human PSRC1 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MEDLEEDVRFIVDETLDFGGLSPSDSREEEDITVLVTPEKPLRRGLSHRS DPNAVAPAPQGVRLSLGPLSPEKLEEILDEANRLAAQLEQCALQDRESAG EGLGPRRVKPSPRRETFVLKDSPVRDLLPTVNSLTRSTPSPSSLTPRLRS NDRKGSVRALRATSGKRPSNMKRESPTCNLFPASKSPASSPLTRSTPPVR GRAGPSGRAAASPPTPIRSVLAPQPSTSNSQRLPRPQGAAAKSSSQLPIP SAIPRPASRMPLTSRSVPPGRGALPPDSLSTRKGLPRPSTAGHRVRESGH KVPVSQRLNLPVMGATRSNLQPPRKVAVPGPTR
    • Amino acids
      1 to 333
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164650 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • DDA3
    • DDA3, mouse, homolog of
    • Differential display and activated by p53
    • FP3214
    • OTTHUMP00000013785
    • OTTHUMP00000013786
    • p53-regulated DDA3
    • Proline/serine-rich coiled-coil 1
    • Proline/serine-rich coiled-coil protein 1
    • PSRC1
    • PSRC1_HUMAN
    see all
  • Function
    Required for normal progression through mitosis. Required for normal congress of chromosomes at the metaphase plate, and for normal rate of chromosomal segregation during anaphase. Plays a role in the regulation of mitotic spindle dynamics. Increases the rate of turnover of microtubules on metaphase spindles, and contributes to the generation of normal tension across sister kinetochores. Recruits KIF2A to the mitotic spindle and spindle poles. May participate in p53/TP53-regulated growth suppression.
  • Tissue specificity
    Widely expressed in adult and fetal tissues, with highest expression in the adult brain and fetal thymus. Not detected in adult skeletal muscle.
  • Sequence similarities
    Belongs to the PSRC1 family.
  • Post-translational
    modifications
    Phosphorylated during mitosis.
  • Cellular localization
    Cytoplasm. Cytoplasm > cytoskeleton > spindle. Cytoplasm > cytoskeleton > spindle pole. Detected at the mitotic spindle and spindle poles. Diffusely distributed throughout the cell during interphase.
  • Information by UniProt

Images

  • ab164650 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164650 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164650.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up