Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP26599
    • SpeciesHuman
    • SequenceKKFKGDSRSAGVPSRVIHIRKLPIDVTEGEVISLGLPFGKVTNLLMLKGK NQAFIEMNTEEAANTMVNYYTSVTPVLRGQPIYIQFSNHKELKTDSSPNQ
    • Molecular weight37 kDa including tags
    • Amino acids45 to 144

Associated products

Specifications

Our Abpromise guarantee covers the use of ab114379 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names
    • 57 kDa RNA binding protein PPTB 1
    • 57 kDa RNA-binding protein PPTB-1
    • Heterogeneous nuclear ribonucleoprotein I
    • Heterogeneous Nuclear Ribonucleoprotein Polypeptide I
    • hnRNP I
    • HNRNP-I
    • HNRNPI
    • HNRPI
    • MGC10830
    • MGC8461
    • Polypyrimidine tract binding protein
    • Polypyrimidine tract binding protein (heterogeneous nuclear ribonucleoprotein I)
    • Polypyrimidine Tract Binding Protein 1
    • Polypyrimidine tract-binding protein 1
    • pPTB
    • PTB
    • PTB 1
    • PTB 2
    • PTB 3
    • PTB 4
    • PTB T
    • PTB1
    • PTB2
    • PTB3
    • PTB4
    • PTBP 1
    • PTBP1
    • PTBP1_HUMAN
    • PTBT
    • RNA Binding Protein
    see all
  • FunctionPlays a role in pre-mRNA splicing and in the regulation of alternative splicing events. Binds to the polypyrimidine tract of introns. May promote RNA looping when bound to two separate polypyrimidine tracts in the same pre-mRNA. May promote the binding of U2 snRNP to pre-mRNA. Cooperates with RAVER1 to modulate switching between mutually exclusive exons during maturation of the TPM1 pre-mRNA.
  • Sequence similaritiesContains 4 RRM (RNA recognition motif) domains.
  • Cellular localizationNucleus.
  • Information by UniProt

Recombinant Human PTBP1 protein images

  • ab114379 on 12.5% SDS-PAGE stained with Coomassie Blue.

References for Recombinant Human PTBP1 protein (ab114379)

ab114379 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114379.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"