Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MDGIVTEVAVGVKRGSDELLSGSVLSSPNSNMSSMVVTANGNDSKKFKGE DKMDGAPSRVLHIRKLPGEVTETEVIALGLPFGKVTNILMLKGKNQAFLE LATEEAAITMVNYYSAVTPHLRNQPIYIQYSNHKELKTDNTLNQRAQAVL QAVTAVQTANTPLSGTTVSESAVTPAQSPVLRIIIDNMYYPVTLDVLHQI FSKFGAVLKIITFTKNNQFQALLQYGDPVNAQQAKLALDGQNIYNACCTL RIDFSKLVNLNVKYNNDKSRDYTRPDLPSGDGQPALDPAIAAAFAKETSL LAVPGALSPLAIPNAAAAAAAAAAGRVGMPGVSAGGNTVLLVSNLNEEMV TPQSLFTLFGVYGDVQRVKILYNKKDSALIQMADGNQSQLAMNHLNGQKM YGKIIRVTLSKHQTVQLPREGLDDQGLTKDFGNSPLHRFKKPGSKNFQNI FPPSATLHLSNIPPSVAEEDLRTLFANTGGTVKAFKFFQRDHKMALLQMA TVEEAIQALIDLHNYNLGENHHLRVSFSKSTI
    • Amino acids
      1 to 532
    • Tags
      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163666 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • brPTB
    • FLJ34897
    • MIBP
    • Neural polypyrimidine tract binding protein
    • Neural polypyrimidine tract-binding protein
    • Neurally enriched homolog of PTB
    • Neurally-enriched homolog of PTB
    • nPTB
    • nPTB 5
    • nPTB 6
    • nPTB 7
    • nPTB 8
    • nPTB5
    • nPTB6
    • nPTB7
    • nPTB8
    • Polypyrimidine tract binding protein 2
    • Polypyrimidine tract-binding protein 2
    • PTB
    • PTB like
    • PTB like protein
    • PTB-like protein
    • PTBLP
    • PTBP 2
    • Ptbp2
    • PTBP2_HUMAN
    • Splicing regulator
    see all
  • Function
    RNA-binding protein which binds to intronic polypyrimidine tracts and mediates negative regulation of exons splicing. May antagonize in a tissue-specific manner the ability of NOVA1 to activate exon selection. Beside its function in pre-mRNA splicing, plays also a role in the regulation of translation. Isoform 5 has a reduced affinity for RNA.
  • Tissue specificity
    Mainly expressed in brain although also detected in other tissues like heart and skeletal muscle. Isoform 1 and isoform 2 are specifically expressed in neuronal tissues. Isoform 3 and isoform 4 are expressed in non-neuronal tissues. Isoform 5 and isoform 6 are truncated forms expressed in non-neuronal tissues.
  • Sequence similarities
    Contains 4 RRM (RNA recognition motif) domains.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab163666 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163666 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163666.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up