Recombinant Human PTCHD1 protein (ab165436)

Overview

  • Product name
    Recombinant Human PTCHD1 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MLDQHHTDLILKLHAAVTKIQVPRPGFNYTFAHICILNNDKTCIVDDIVH VLEELKNARATNRTNFAITYPITHLKDGRAVYNGHQLGGVTVHSKDRVKS AEAIQLTYYLQSINSLNDMVAERWESSFCDTVRLFQKSNSKVKMYPYTSS SLREDFQKTSRVSERYLVTSLILVVTMAILCCSMQDCVRSKPWLGLLGLV TISLATLTAAGIINLTGGKYNSTFLGVPFVMLGNYYSSFFCFRLLVVLTR FLKGQE
    • Amino acids
      1 to 256
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165436 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 9630036J22Rik
    • AI848149
    • FLJ30296
    • Gm387
    • MGC149798
    • Patched domain containing 1
    • Patched domain-containing protein 1
    • PTCHD1
    • PTHD1_HUMAN
    • RGD1564527
    • RP23-152D15.3
    see all
  • Tissue specificity
    Widely expressed, including in various regions of the brain with highest expression in the gray and white cerebellum, followed by the cerebellar vermis and the pituitary gland.
  • Sequence similarities
    Belongs to the patched family.
    Contains 1 SSD (sterol-sensing) domain.
  • Cellular localization
    Cell membrane.
  • Information by UniProt

Images

  • ab165436 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165436 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165436.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up