Recombinant Human PTGES2 protein (ab107954)

Overview

  • Product nameRecombinant Human PTGES2 protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionA6NHH0
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMKAVNEQGKEVTEFGNKYWLMLNEKEAQQV YGGKEARTEEMKWRQWADDWLVHLISPNVYRTPTEALASFDYIVREGKFG AVEGAVAKYMGAAAMYLISKRLKSRHRLQDNVREDLYEAADKWVAAVGKD RPFMGGQKPNLADLAVYGVLRVMEGLDAFDDLMQHTHIQPWYLRVERAIT EASPAH
    • Molecular weight24 kDa including tags
    • Amino acids1 to 206
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab107954 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry
    MALDI-TOF
  • Purity> 95 % SDS-PAGE.
    ab107954 was purified by using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: 20% Glycerol, 0.2M Sodium chloride, 20mM Tris HCl, 2mM DTT, pH 8.0

General Info

  • Alternative names
    • C9orf15
    • FLJ14038
    • Gamma interferon activated transcriptional element binding factor 1
    • GATE binding factor 1
    • GBF 1
    • GBF1
    • Membrane associated prostaglandin E synthase 2
    • MGC11289
    • Microsomal prostaglandin E synthase 2
    • mPGES 2
    • mPGES-2
    • PGES2
    • PGES2_HUMAN
    • Prostaglandin E synthase 2
    • Prostaglandin E synthase 2 truncated form
    • PTGES 2
    • PTGES2
    see all
  • FunctionIsomerase that catalyzes the conversion of unstable intermediate of prostaglandin E2 H2 (PGH2) into the more stable prostaglandin E2 (PGE2) form. May also have transactivation activity toward IFN-gamma (IFNG), possibly via an interaction with CEBPB; however, the relevance of transcription activation activity remains unclear.
  • Tissue specificityWidely expressed. Expressed in the heart, including apex, inter-ventricular septum, both atria and ventricles, but not in the aorta. Also expressed in fetal heart. Detected in various regions of the brain: cerebellum; occipital, frontal and parietal lobes. Also expressed in the lymph nodes, skeletal muscle, kidney and trachea, but not in the thymus or lung. Overexpressed in colorectal cancer.
  • PathwayLipid metabolism; prostaglandin biosynthesis.
  • Sequence similaritiesBelongs to the GST superfamily.
    Contains 1 glutaredoxin domain.
    Contains 1 GST C-terminal domain.
  • Cellular localizationGolgi apparatus membrane and Cytoplasm > perinuclear region. Synthetized as a Golgi membrane-bound protein, which is further cleaved into the predominant soluble truncated form. The truncated form is cytoplasmic and is enriched in the perinuclear region.
  • Information by UniProt

Recombinant Human PTGES2 protein images

  • 15% SDS-PAGE analysis of ab107954 (3 µg).

References for Recombinant Human PTGES2 protein (ab107954)

ab107954 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab107954.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"