Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ16647
    • SpeciesHuman
    • SequencePQRDPEIYTDPEVFKYNRFLNPDGSEKKDFYKDGKRLKNYNMPWGAGHNH CLGRSYAVNSIKQFVFLVLVHLDLELINADVEIPEFDLSRYGFGLMQPEH DVPVRYRIRP
    • Molecular weight38 kDa including tags
    • Amino acids391 to 500

Specifications

Our Abpromise guarantee covers the use of ab114516 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml. This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CYP8
    • CYP8A1
    • Cytochrome P450, family 8, subfamily A, polypeptide 1
    • EC 5.3.99.4
    • MGC126858
    • MGC126860
    • OTTHUMP00000031777
    • PGIS
    • Prostacyclin synthase
    • Prostaglandin I2 (prostacyclin) synthase
    • Prostaglandin I2 synthase
    • PTGI
    • PTGIS
    • PTGIS_HUMAN
    see all
  • FunctionCatalyzes the isomerization of prostaglandin H2 to prostacyclin (= prostaglandin I2).
  • Tissue specificityWidely expressed; particularly abundant in ovary, heart, skeletal muscle, lung and prostate.
  • Sequence similaritiesBelongs to the cytochrome P450 family.
  • Cellular localizationEndoplasmic reticulum membrane.
  • Information by UniProt

Recombinant Human PTGIS protein images

  • ab114516 analysed by 12.5% SDS-PAGE and stained with Coomassie Blue.

References for Recombinant Human PTGIS protein (ab114516)

ab114516 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114516.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"