Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MAWAALLGLLAALLLLLLLSRRRTRRPGEPPLDLGSIPWLGYALDFGKDA ASFLTRMKEKHGDIFTILVGGRYVTVLLDPHSYDAVVWEPRTRLDFHAYA IFLMERIFDVQLPHYSPSDEKARMKLTLLHRELQALTEAMYTNLHAVLLG DATEAGSGWHEMGLLDFSYSFLLRAGYLTLYGIEALPRTHESQAQDRVHS ADVFHTFRQLDRLLPKLARGSLSVGDKDHMCSVKSRLWKLLSPARLARRA HRSKWLESYLLHLEEMGVSEEMQARALVLQLWATQGNMGPAAFWLLLFLL KNPEALAAVRGELESILWQAEQPVSQTTTLPQKVLDSTPVLDSVLSESLR LTAAPFITREVVVDLAMPMADGREFNLRRGDRLLLFPFLSPQRDPEIYTD PEVFKYNRFLNPDGSEKKDFYKDGKRLKNYNMPWGAGHNHCLGRSYAVNS IKQFVFLVLVHLDLELINADVEIPEFDLSRYGFGLMQPEHDVPVRYRIRP
    • Molecular weight
      81 kDa including tags
    • Amino acids
      1 to 500

Specifications

Our Abpromise guarantee covers the use of ab114517 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml. This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CYP8
    • CYP8A1
    • Cytochrome P450, family 8, subfamily A, polypeptide 1
    • EC 5.3.99.4
    • MGC126858
    • MGC126860
    • OTTHUMP00000031777
    • PGIS
    • Prostacyclin synthase
    • Prostaglandin I2 (prostacyclin) synthase
    • Prostaglandin I2 synthase
    • PTGI
    • PTGIS
    • PTGIS_HUMAN
    see all
  • Function
    Catalyzes the isomerization of prostaglandin H2 to prostacyclin (= prostaglandin I2).
  • Tissue specificity
    Widely expressed; particularly abundant in ovary, heart, skeletal muscle, lung and prostate.
  • Sequence similarities
    Belongs to the cytochrome P450 family.
  • Cellular localization
    Endoplasmic reticulum membrane.
  • Information by UniProt

Images

  • ab114517 analysed by 12.5% SDS-PAGE and stained with Coomassie Blue.

References

ab114517 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114517.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up