Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MAWAALLGLLAALLLLLLLSRRRTRRPGEPPLDLGSIPWLGYALDFGKDA ASFLTRMKEKHGDIFTILVGGRYVTVLLDPHSYDAVVWEPRTRLDFHAYA IFLMERIFDVQLPHYSPSDEKARMKLTLLHRELQALTEAMYTNLHAVLLG DATEAGSGWHEMGLLDFSYSFLLRAGYLTLYGIEALPRTHESQAQDRVHS ADVFHTFRQLDRLLPKLARGSLSVGDKDHMCSVKSRLWKLLSPARLARRA HRSKWLESYLLHLEEMGVSEEMQARALVLQLWATQGNMGPAAFWLLLFLL KNPEALAAVRGELESILWQAEQPVSQTTTLPQKVLDSTPVLDSVLSESLR LTAAPFITREVVVDLAMPMADGREFNLRRGDRLLLFPFLSPQRDPEIYTD PEVFKYNRFLNPDGSEKKDFYKDGKRLKNYNMPWGAGHNHCLGRSYAVNS IKQFVFLVLVHLDLELINADVEIPEFDLSRYGFGLMQPEHDVPVRYRIRP
    • Molecular weight
      81 kDa including tags
    • Amino acids
      1 to 500

Specifications

Our Abpromise guarantee covers the use of ab114517 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml. This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CYP8
    • CYP8A1
    • Cytochrome P450, family 8, subfamily A, polypeptide 1
    • EC 5.3.99.4
    • MGC126858
    • MGC126860
    • OTTHUMP00000031777
    • PGIS
    • Prostacyclin synthase
    • Prostaglandin I2 (prostacyclin) synthase
    • Prostaglandin I2 synthase
    • PTGI
    • PTGIS
    • PTGIS_HUMAN
    see all
  • Function
    Catalyzes the isomerization of prostaglandin H2 to prostacyclin (= prostaglandin I2).
  • Tissue specificity
    Widely expressed; particularly abundant in ovary, heart, skeletal muscle, lung and prostate.
  • Sequence similarities
    Belongs to the cytochrome P450 family.
  • Cellular localization
    Endoplasmic reticulum membrane.
  • Information by UniProt

Recombinant Human PTGIS protein images

  • ab114517 analysed by 12.5% SDS-PAGE and stained with Coomassie Blue.

References for Recombinant Human PTGIS protein (ab114517)

ab114517 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114517.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up