Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MAVSEHQLLHDKGKSIQDLRRRFFLHHLIAEIHTAEIRATSEVSPNSKPS PNTKNHPVRFGSDDEGRYLTQETNKVETYKEQPLKTPGKKKKGKPGKRKE QEKKKRRTRSAWLDSGVTGSGLEGDHLSDT STTSLELDSRLEHHHHHH
    • Molecular weight
      17 kDa including tags
    • Amino acids
      37 to 175
    • Tags
      His tag C-Terminus
    • Additional sequence information
      Mature.

Specifications

Our Abpromise guarantee covers the use of ab173029 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    HPLC

    SDS-PAGE

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .

  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: PBS, Sodium chloride

    Lyophilized from a 0.2 µm filtered solution of 20mM PBS,150mM NaCl,pH7.4.

  • Reconstitution
    It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.

General Info

  • Alternative names
    • HHM
    • MGC14611
    • Osteostatin
    • Parathyroid hormon like hormone isoform 2 preproprotein
    • Parathyroid hormone like hormone
    • Parathyroid hormone like hormone isoform 1 preproprotein
    • Parathyroid hormone like protein
    • Parathyroid hormone like related protein
    • Parathyroid hormone related protein
    • Parathyroid hormone-like protein
    • Parathyroid like protein
    • PLP
    • PTH related protein
    • PTH-rP
    • PTHLH
    • PTHR
    • PTHR_HUMAN
    • PTHrP
    • PTHrP[107-139]
    see all
  • Function
    Neuroendocrine peptide which is a critical regulator of cellular and organ growth, development, migration, differentiation and survival and of epithelial calcium ion transport. Regulates endochondral bone development and epithelial-mesenchymal interactions during the formation of the mammary glands and teeth. Required for skeletal homeostasis. Promotes mammary mesenchyme differentiation and bud outgrowth by modulating mesenchymal cell responsiveness to BMPs. Upregulates BMPR1A expression in the mammary mesenchyme and this increases the sensitivity of these cells to BMPs and allows them to respond to BMP4 in a paracrine and/or autocrine fashion. BMP4 signaling in the mesenchyme, in turn, triggers epithelial outgrowth and augments MSX2 expression, which causes the mammary mesenchyme to inhibit hair follicle formation within the nipple sheath (By similarity). Promotes colon cancer cell migration and invasion in an integrin alpha-6/beta-1-dependent manner through activation of Rac1.
    Osteostatin is a potent inhibitor of osteoclastic bone resorption.
  • Tissue specificity
    Ubiquitous. Also expressed in the mammary gland.
  • Involvement in disease
    Brachydactyly E2
  • Sequence similarities
    Belongs to the parathyroid hormone family.
  • Post-translational
    modifications
    There are 3 principal secretory forms, called PTHrP[1-36], PTHrP[38-94], and osteostatin (PTHrP[107-139]) arising from endoproteolytic cleavage of the initial translation product. Each of these secretory forms is believed to have one or more of its own receptors that mediates the normal paracrine, autocrine and endocrine actions.
  • Cellular localization
    Cytoplasm. Nucleus. Secreted.
  • Information by UniProt

References

ab173029 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab173029.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up