Recombinant Human PTP4A1 protein (ab101827)

Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionQ93096
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMARMNRPAPVEVTYKNMRFLITHNPTNATL NKFIEELKKYGVTTIVRVCEATYDTTLVEKEGIHVLDWPFDDGAPPSNQI VDDWLSLVKIKFREEPGCCIAVHCVAGLGRAPVLVALALIEGGMKYEDAV QFIRQKRRGAFNSKQLLYLEKYRPKMRLRFKDSNGHRNNC
    • Molecular weight22 kDa including tags
    • Amino acids1 to 170
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab101827 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 90 % SDS-PAGE.
    ab101827 was purified using conventional chromatography.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: 20% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • HH 72
    • HH72
    • Hypothetical protein DKFZp779M0721
    • Phosphatase of regenerating liver 1
    • PRL 1
    • PRL-1
    • PRL1
    • Protein tyrosine phosphatase PTPCAAX1
    • Protein tyrosine phosphatase type IVA 1
    • Protein tyrosine phosphatase type IVA member 1
    • Protein-tyrosine phosphatase 4a1
    • Protein-tyrosine phosphatase of regenerating liver 1
    • Protein-tyrosine phosphatase, type 4A, 1
    • PTP(CAAXI)
    • Ptp4a1
    • PTPCAAX1
    • TP4A1_HUMAN
    see all
  • FunctionProtein tyrosine phosphatase which stimulates progression from G1 into S phase during mitosis. May play a role in the development and maintenance of differentiating epithelial tissues. Enhances cell proliferation, cell motility and invasive activity, and promotes cancer metastasis.
  • Tissue specificityExpressed in bone marrow, lymph nodes, T lymphocytes, spleen, thymus and tonsil. Overexpressed in tumor cell lines.
  • Sequence similaritiesBelongs to the protein-tyrosine phosphatase family.
    Contains 1 tyrosine-protein phosphatase domain.
  • Developmental stageExpressed in fetal liver.
  • Post-translational
    modifications
    Farnesylated. Farnesylation is required for membrane targeting. Unfarnesylated forms are shifted into the nucleus.
  • Cellular localizationCell membrane. Early endosome. Endoplasmic reticulum. Cytoplasm. Cytoplasm > cytoskeleton > spindle. And mitotic spindle.
  • Information by UniProt

Recombinant Human PTP4A1 protein images

  • 15% SDS-PAGE analysis of 3µg ab101827

References for Recombinant Human PTP4A1 protein (ab101827)

ab101827 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab101827.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"