Recombinant human PTP4A1 protein (ab157013)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      ARMNRPAPVEVTYKNMRFLITHNPTNATLNKFIEELKKYGVTTIVRVCEA TYDTTLVEKEGIHVLDWPFDDGAPPSNQIVDDWLSLVKIKFREEPGCCIA VHCVAGLGRAPVLVALALIEGGMKYEDAVQFIRQKRRGAFNSKQLLYLEK YRPKMRLRFKDSNGHRNNCCIQ
    • Molecular weight
      20 kDa including tags
    • Amino acids
      2 to 173
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab157013 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity
    Specific activity of ab157013 is 0.168U/µg. One unit will hydrolyze 1pmol para-nitrophenyl phosphate (PNPP) per minute at 37°C. Assay buffer: 50mM TRIS, pH 7.4, containing 150mM sodium chloride, 5mM dithiothreitol and 12.5mM PNPP.
  • Applications

    Functional Studies

    SDS-PAGE

  • Purity
    >90% by SDS-PAGE.

  • Form
    Liquid
  • Additional notes
    Dilution of the enzyme followed by refreezing may lead to loss of activity.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.06% DTT, 0.395% Tris HCl, 0.05% Tween, 20% Glycerol, 0.58% Sodium chloride

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names
    • HH 72
    • HH72
    • Hypothetical protein DKFZp779M0721
    • Phosphatase of regenerating liver 1
    • PRL 1
    • PRL-1
    • PRL1
    • Protein tyrosine phosphatase PTPCAAX1
    • Protein tyrosine phosphatase type IVA 1
    • Protein tyrosine phosphatase type IVA member 1
    • Protein-tyrosine phosphatase 4a1
    • Protein-tyrosine phosphatase of regenerating liver 1
    • Protein-tyrosine phosphatase, type 4A, 1
    • PTP(CAAXI)
    • Ptp4a1
    • PTPCAAX1
    • TP4A1_HUMAN
    see all
  • Function
    Protein tyrosine phosphatase which stimulates progression from G1 into S phase during mitosis. May play a role in the development and maintenance of differentiating epithelial tissues. Enhances cell proliferation, cell motility and invasive activity, and promotes cancer metastasis.
  • Tissue specificity
    Expressed in bone marrow, lymph nodes, T lymphocytes, spleen, thymus and tonsil. Overexpressed in tumor cell lines.
  • Sequence similarities
    Belongs to the protein-tyrosine phosphatase family.
    Contains 1 tyrosine-protein phosphatase domain.
  • Developmental stage
    Expressed in fetal liver.
  • Post-translational
    modifications
    Farnesylated. Farnesylation is required for membrane targeting. Unfarnesylated forms are shifted into the nucleus.
  • Cellular localization
    Cell membrane. Early endosome. Endoplasmic reticulum. Cytoplasm. Cytoplasm > cytoskeleton > spindle. And mitotic spindle.
  • Information by UniProt

References

ab157013 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab157013.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up