Recombinant Human PTPLAD1 protein (ab162574)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MENQVLTPHVYWAQRHRELYLRVELSDVQNPAISITENVLHFKAQGHGAK GDNVYEFHLEFLDLVKPEPVYKLTQRQVNITVQKKVSQWWERLTKQEKRP LFLAPDFDRWLDE
    • Amino acids
      1 to 113
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162574 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 3 hydroxyacyl CoA dehydratase 3
    • B IND1
    • Butyrate induced protein 1
    • Butyrate induced transcript 1
    • FLJ90376
    • HACD3
    • hB ind1
    • HSPC121
    • Protein tyrosine phosphatase like A domain containing 1
    • Protein tyrosine phosphatase like A domain containing protein 1
    • Protein tyrosine phosphatase like protein PTPLAD1
    • PTPLAD 1
    • Very long chain (3R) 3 hydroxyacyl [acyl carrier protein] dehydratase 3
    see all
  • Relevance
    PTPLAD1 is a component of Rac1-signaling pathways leading to the modulation of gene expression. It potentiates different effects of the small GTPase Rac1, such as c-Jun N-terminal kinase activation and transcriptional activity of nuclear factor kappaB (NF-kappaB).It plays a crucial role in HCV RNA replication and the propagation of JFH1 virus through interaction with viral and host proteins.
  • Cellular localization
    Membrane; Multi-pass membrane protein

Images

  • ab162574 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162574 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162574.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up