Overview

  • Product name
    Recombinant Human PTPLB protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAAVAATAAAKGNGGGGGRAGAGDASGTRKKKGPGPLATAYLVIYNVVMT AGWLVIAVGLVRAYLAKGSYHSLYYSIEKPLKFFQTGALLEILHCAIGIV PSSVVLTSFQVMSRVFLIWAVTHSVKEVQSEDSVLLFVIAWTITEIIRYS FYTFSLLNHLPYLIKWARYTLFIVLYPMGVSGELLTIYAALPFVRQAGLY SISLPNKYNFSFDYYAFLILIMISYIPIFPQLYFHMIHQRRKILSHTEEH KKFE
    • Amino acids
      1 to 254
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165888 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 3 hydroxyacyl CoA dehydratase 2
    • 3-hydroxyacyl-CoA dehydratase 2
    • HACD2
    • HACD2_HUMAN
    • Protein tyrosine phosphatase like (proline instead of catalytic arginine) member b
    • Protein tyrosine phosphatase like member B
    • Protein-tyrosine phosphatase-like member B
    • PTPLB
    • Very-long-chain (3R)-3-hydroxyacyl-[acyl-carrier protein] dehydratase 2
    see all
  • Function
    Responsible for the dehydration step in very long-chain fatty acids (VLCFAs) synthesis.
  • Tissue specificity
    Highly expressed in testis, spleen, prostate, colon and heart, followed by moderate expression in thymus, ovary, small intestine, peripheral blood leukocytes, liver, skeletal muscle and pancreas. Weakly detected in kidney, placenta, brain and lung.
  • Sequence similarities
    Belongs to the very long-chain fatty acids dehydratase HACD family.
  • Cellular localization
    Endoplasmic reticulum membrane.
  • Information by UniProt

Images

  • ab165888 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165888 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165888.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up