Recombinant Human PTPMT1 protein (ab116204)

Overview

  • Product nameRecombinant Human PTPMT1 protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionQ8WUK0
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMGSHMKVPGRAHRDWYHRIDPTVLLGALPL RSLTRQLVQDENVRGVITMNEEYETRFLCNSSQEWKRLGVEQLRLSTVDM TGIPTLDNLQKGVQFALKYQSLGQCVYVHCKAGRSRSATMVAAYLIQVHK WSPEEAVRAIAKIRSYIHIRPGQLDVLKEFHKQITARATKDGTFVISKT
    • Molecular weight23 kDa including tags
    • Amino acids28 to 201
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab116204 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry
    MALDI-TOF
  • Purity> 95 % SDS-PAGE.
    ab116204 was purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 10% Glycerol, 0.02% DTT, 0.88% Sodium chloride

General Info

  • Alternative names
    • DUSP23
    • FLJ46081
    • MOSP
    • NB4 apoptosis/differentiation related protein
    • Phosphatidylglycerophosphatase and protein-tyrosine phosphatase 1
    • Phosphoinositide lipid phosphatase
    • PLIP
    • PNAS 129
    • protein tyrosine phosphatase mitochondrial 1
    • Protein-tyrosine phosphatase mitochondrial 1
    • pten like phosphatase
    • PTEN-like phosphatase
    • PTPM1_HUMAN
    • Ptpmt1
    see all
  • FunctionProtein phosphatase that specifically mediates dephosphorylation of mitochondrial proteins, thereby playing an essential role in ATP production. Has probably a preference for proteins phosphorylated on Ser and/or Thr residues compared to proteins phosphorylated on Tyr residues. Probably involved in regulation of insulin secretion in pancreatic beta cells.
  • Sequence similaritiesBelongs to the protein-tyrosine phosphatase family. Non-receptor class dual specificity subfamily.
    Contains 1 tyrosine-protein phosphatase domain.
  • Cellular localizationMitochondrion inner membrane. Associated with the inner membrane.
  • Information by UniProt

Recombinant Human PTPMT1 protein images

  • 15% SDS-PAGE analysis of 3 µg ab116204.

References for Recombinant Human PTPMT1 protein (ab116204)

ab116204 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116204.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"