Recombinant Human PTPMT1 protein (ab116204)

Overview

  • Product name
    Recombinant Human PTPMT1 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGSHMKVPGRAHRDWYHRIDPTVLLGALPL RSLTRQLVQDENVRGVITMNEEYETRFLCNSSQEWKRLGVEQLRLSTVDM TGIPTLDNLQKGVQFALKYQSLGQCVYVHCKAGRSRSATMVAAYLIQVHK WSPEEAVRAIAKIRSYIHIRPGQLDVLKEFHKQITARATKDGTFVISKT
    • Molecular weight
      23 kDa including tags
    • Amino acids
      28 to 201
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab116204 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 95 % SDS-PAGE.
    ab116204 was purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 10% Glycerol, 0.02% DTT, 0.88% Sodium chloride

General Info

  • Alternative names
    • DUSP23
    • FLJ46081
    • MOSP
    • NB4 apoptosis/differentiation related protein
    • Phosphatidylglycerophosphatase and protein-tyrosine phosphatase 1
    • Phosphoinositide lipid phosphatase
    • PLIP
    • PNAS 129
    • protein tyrosine phosphatase mitochondrial 1
    • Protein-tyrosine phosphatase mitochondrial 1
    • pten like phosphatase
    • PTEN-like phosphatase
    • PTPM1_HUMAN
    • Ptpmt1
    see all
  • Function
    Protein phosphatase that specifically mediates dephosphorylation of mitochondrial proteins, thereby playing an essential role in ATP production. Has probably a preference for proteins phosphorylated on Ser and/or Thr residues compared to proteins phosphorylated on Tyr residues. Probably involved in regulation of insulin secretion in pancreatic beta cells.
  • Sequence similarities
    Belongs to the protein-tyrosine phosphatase family. Non-receptor class dual specificity subfamily.
    Contains 1 tyrosine-protein phosphatase domain.
  • Cellular localization
    Mitochondrion inner membrane. Associated with the inner membrane.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3 µg ab116204.

References

ab116204 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab116204.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up