Recombinant Human PTPN18 protein (ab161978)

Overview

  • Product name
    Recombinant Human PTPN18 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MSRSLDSARSFLERLEARGGREGAVLAGEFSKRCERYWAQEQEPLQTGLF CITLIKEKWLNEDIMLRTLKVTFQKESRSVYQLQYMSWPDRGVPSSPDHM LAMVEEARRLQGSGPEPLCVHCSAGCGRTGVLCTVDYVRQLLLTQMIPPD FSLFDVVLKMRKQRPAAVQTEEQYRFLYHTVAQMFCSTLQNASPHYQNIK ENCAPLYDDALFLRTPQALLAIPRPPGGVLRSISVPGSPGHAMADTYAVV QKRGAPAGAGSGTQTGTGTGARSAEEAPLYSKVTPRAQRPGAHAEDARGT LPGRVPADQSPAGSGAYEDVAGGAQTGGLGFNLRIGRPKGPRDPPAEWTR V
    • Amino acids
      1 to 351
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161978 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • BDP 1
    • Brain derived phosphatase
    • Brain-derived phosphatase
    • Protein tyrosine phosphatase non receptor type 18
    • Protein tyrosine phosphatase non receptor type 18 brain derived
    • PTN18_HUMAN
    • PTP HSCF
    • PTPN 18
    • PTPN18
    • Tyrosine protein phosphatase non receptor type 18
    • Tyrosine-protein phosphatase non-receptor type 18
    see all
  • Function
    Differentially dephosphorylate autophosphorylated tyrosine kinases which are known to be overexpressed in tumor tissues.
  • Tissue specificity
    Expressed in brain, colon and several tumor-derived cell lines.
  • Sequence similarities
    Belongs to the protein-tyrosine phosphatase family. Non-receptor class 4 subfamily.
    Contains 1 tyrosine-protein phosphatase domain.
  • Cellular localization
    Nucleus. Cytoplasm.
  • Information by UniProt

Images

  • ab161978 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161978 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161978.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up