Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      KKAFSKEKMEKTKVRTRENLEKTRLKTKENLEKTRHTLEKRMNKLGTRLV PAERREKLKTSRDKLRKSFTPDHVVYARSKTAVYKVPPF
    • Amino acids
      233 to 321
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab166164 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 2310075E07Rik
    • AW546441
    • Cavin
    • Cavin 1
    • Cavin-1
    • CAVIN1
    • CGL4
    • FKSG13
    • FLJ90031
    • MGC118550
    • OTTMUSP00000002049
    • Polymerase I and transcript release factor
    • Ptrf
    • PTRF_HUMAN
    • RNA polymerase I and transcript release factor
    • RP23-279L23.6
    • TTF I interacting peptide 12
    see all
  • Function
    Plays an important role in caveolae formation and organization. Required for the sequestration of mobile caveolin into immobile caveolae. Termination of transcription by RNA polymerase I involves pausing of transcription by TTF1, and the dissociation of the transcription complex, releasing pre-rRNA and RNA polymerase I from the template. PTRF is required for dissociation of the ternary transcription complex.
  • Involvement in disease
    Congenital generalized lipodystrophy 4
  • Sequence similarities
    Belongs to the PTRF/SDPR family.
  • Post-translational
    modifications
    Phosphorylated. Present in active and inactive forms. Changes in phosphorylation pattern may alter activity.
    Five truncated forms are found in the caveolae. These are thought to be the result of proteolysis and may be phosphorylation-dependent.
  • Cellular localization
    Membrane > caveola. Cell membrane. Microsome. Endoplasmic reticulum. Cytoplasm > cytosol. Mitochondrion. Nucleus. Found at the surface of the caveolae. Also found in the plasma membrane, microsomal and cytosolic fractions and at a low level in the mitochondrial and nuclear fractions. Translocates to the cytoplasm from the caveolae upon insulin stimulation. CAV1 is necessary to recruit it to the cell membrane (By similarity). Co-localizes with CAV1 in lipid rafts in adipocytes.
  • Information by UniProt

Images

  • ab166164 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab166164 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab166164.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up