Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionQ9Y3E5
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMEYKMILVVRNDLKMGKGKVAAQCSHAAVS AYKQIQRRNPEMLKQWEYCGQPKVVVKAPDEETLIALLAHAKMLGLTVSL IQDAGRTQIAPGSQTVLGIGPGPADLIDKVTGHLKLY
    • Molecular weight15 kDa including tags
    • Amino acids64 to 179
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab101645 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 95 % SDS-PAGE.
    ab101645 was purified using anion-exchange chromatography (DEAE sepharose resin) and gel-filtration chromatography (Sephacryl S-200) with 20mM Tris pH 7.5, 2mM EDTA.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: 0% None
    Constituents: 10% Glycerol, 20mM Tris HCl, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • Bcl 2 inhibitor of transcription 1
    • Bcl-2 inhibitor of transcription 1
    • BIT 1
    • BIT1
    • CGI 147
    • CGI147
    • mitochondrial
    • Peptidyl tRNA hydrolase 2 mitochondrial
    • Peptidyl-tRNA hydrolase 2
    • PTH 2
    • PTH2
    • PTH2_HUMAN
    • PTRH 2
    • PTRH2
    see all
  • FunctionThe natural substrate for this enzyme may be peptidyl-tRNAs which drop off the ribosome during protein synthesis.
    Promotes caspase-independent apoptosis by regulating the function of two transcriptional regulators, AES and TLE1.
  • Sequence similaritiesBelongs to the PTH2 family.
  • Cellular localizationMitochondrion.
  • Information by UniProt

Recombinant Human PTRH2 protein images

  • ab101645 at 3 µg analysed by 15% SDS PAGE

References for Recombinant Human PTRH2 protein (ab101645)

ab101645 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab101645.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"