Recombinant Human PU.1/Spi1 protein (ab152701)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MEGFPLVPPPSEDLVPYDTDLYQRQTHEYYPYLSSDGESHSDHYWDFHPH HVHSEFESFAENNFTELQSVQPPQLQQLYRHMELEQMHVLDTPMVPPHPS LGHQVSYLPRMCLQYPSLSP
    • Molecular weight
      39 kDa including tags
    • Amino acids
      7 to 126

Associated products

Specifications

Our Abpromise guarantee covers the use of ab152701 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 µg/µl.<
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • transcription factor spi1
    • 31 kDa Transforming Protein
    • 31 kDa-transforming protein
    • cb1086
    • Hematopoietic transcription factor PU.1
    • OF
    • oncogene spi1
    • PU.1
    • SFFV virus-induced murine erythroleukemia oncogene, mouse, homolog of
    • SFPI1
    • si:by184l24.2
    • SPI 1
    • SPI 1 proto oncogene
    • SPI A
    • Spi1
    • SPI1_HUMAN
    • Spleen focus forming virus (SFFV) proviral integration oncogene spi1
    • Spleen focus forming virus proviral integration oncogene spi1
    • Transcription factor PU.1
    see all
  • Function
    Binds to the PU-box, a purine-rich DNA sequence (5'-GAGGAA-3') that can act as a lymphoid-specific enhancer. This protein is a transcriptional activator that may be specifically involved in the differentiation or activation of macrophages or B-cells. Also binds RNA and may modulate pre-mRNA splicing.
  • Sequence similarities
    Belongs to the ETS family.
    Contains 1 ETS DNA-binding domain.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab157012 stained with Coomassie Blue.

References

ab152701 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152701.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up