Overview

  • Product name
    Recombinant Human Pur B protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGSMADGDSGSERGGGGGPCGFQPASRGGG EQETQELASKRLDIQNKRFYLDVKQNAKGRFLKIAEVGAGGSKSRLTLSM AVAAEFRDSLGDFIEHYAQLGPSSPEQLAAGAEEGGGPRRALKSEFLVRE NRKYYLDLKENQRGRFLRIRQTVNRGGGGFGAGPGPGGLQSGQTIALPAQ GLIEFRDALAKLIDDYGGEDDELAGGPGGGAGGPGGGLYGELPEGTSITV DSKRFFFDVGCNKYGVFLRVSEVKPSYRNAITVPFKAWGKFGGAFCRYAD EMKEIQERQRDKLYERRGGGSGGGEESEGEEVDED
    • Molecular weight
      36 kDa including tags
    • Amino acids
      1 to 312
    • Tags
      His tag N-Terminus
    • Additional sequence information
      NP_150093.

Specifications

Our Abpromise guarantee covers the use of ab180276 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry
    MALDI-TOF
  • Purity
    >95% by SDS-PAGE .
    ab180276 is purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8
    Constituents: 0.32% Tris HCl, 0.88% Sodium chloride, 20% Glycerol, 0.02% DTT

General Info

  • Alternative names
    • Pur beta
    • purB
    • PURB_HUMAN
    • PURBETA
    • Purine rich element binding protein B
    • Purine-rich element-binding protein B
    • transcriptional activator protein Pur beta
    • Transcriptional activator protein Pur-beta
    see all
  • Function
    Has capacity to bind repeated elements in single-stranded DNA such as the purine-rich single strand of the PUR element located upstream of the MYC gene. Plays a role in the control of vascular smooth muscle (VSM) alpha-actin gene transcription as repressor in myoblasts and fibroblasts. Participates in transcriptional and translational regulation of alpha-MHC expression in cardiac myocytes by binding to the purine-rich negative regulatory (PNR) element. Modulates constitutive liver galectin-3 gene transcription by binding to its promoter. May play a role in the dendritic transport of a subset of mRNAs.
  • Tissue specificity
    Expressed in myocardium of heart failure patients.
  • Sequence similarities
    Belongs to the PUR DNA-binding protein family.
  • Post-translational
    modifications
    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab180276 (3μg).

References

ab180276 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab180276.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up