Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ00577
    • SpeciesHuman
    • SequenceTQGQTIALPAQGLIEFRDALAKLIDDYGVEEEPAELPEGTSLTVDNKRFF FDVGSNKYGVFMRVSEVKPTYRNSITVPYKVWAKFGHTFCKYSEEMKKIQ EKQREKRAAC
    • Molecular weight38 kDa including tags
    • Amino acids183 to 292

Associated products

Specifications

Our Abpromise guarantee covers the use of ab114480 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • PUR ALPHA
    • PUR1
    • purA
    • PURA_HUMAN
    • PURALPHA
    • Purine rich element binding protein A
    • Purine rich single stranded DNA binding protein alpha
    • Purine-rich single-stranded DNA-binding protein alpha
    • Transcriptional activator protein PUR alpha
    • Transcriptional activator protein Pur-alpha
    see all
  • FunctionThis is a probable transcription activator that specifically binds the purine-rich single strand of the PUR element located upstream of the MYC gene. May play a role in the initiation of DNA replication and in recombination.
  • Sequence similaritiesBelongs to the PUR DNA-binding protein family.
  • Cellular localizationNucleus.
  • Information by UniProt

Recombinant Human PURA protein images

  • 12.5% SDS-PAGE showing ab114480 at approximately 37.73kDa stained with Coomassie Blue.

References for Recombinant Human PURA protein (ab114480)

ab114480 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114480.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"