Overview

Description

  • NatureRecombinant
  • SourceSaccharomyces cerevisiae
  • Amino Acid Sequence
    • SpeciesHuman
    • SequenceMERARRRGGGGGRGRGGKNVGGSGLSKSRLYPQAQHSHYPHYAASATPNQ AGGA AEIQELASKRVDIQKKRFYLDVKQSSRGRFLKIAEVWIGRGRQD NIRKSKLTLS LSVAAELKDCLGDFIEHYAHLGLKGHRQEHGHSKEQGS RRRQKHSAPSPPVSVG SEEHPHSVLKTDYIERDNRKYYLDLKENQRGR FLRIRQTMMRGTGMIGYFGHSL GQEQTIVLPAQGMIEFRDALVQLIED YGEGDIEERRGGDDDPLELPEGTSFRVD NKRFYFDVGSNKYGIFLKVS EVRPPYRNTITVPFKAWTRFGENFIKYEEEMRKI CNSHKEKRMDGRKA SGEEQECLD

Associated products

Specifications

Our Abpromise guarantee covers the use of ab88943 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity> 90 % SDS-PAGE.
    Purified by Affinity chromatography.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20ºC.

    Preservative: None
    Constituents: 30% Glycerol, 0.5% Triton-X-100, 50mM HEPES, 30mM Glutathione, 100mM Sodium chloride, 1mM DTT, pH 7.5

General Info

  • Alternative names
    • MGC119274
    • Pur gamma
    • PURG A
    • PURG B
    • Purine rich element binding protein G
    • Purine rich element binding protein gamma
    see all
  • RelevanceThe exact function of PURG is not known, however, its encoded product is highly similar to purine-rich element binding protein A. The latter is a DNA-binding protein which binds preferentially to the single strand of the purine-rich element termed PUR, and has been implicated in the control of both DNA replication and transcription. PURG lies in close proximity to the Werner syndrome gene, but on the opposite strand, on chromosome 8p11. Two transcript variants encoding different isoforms have been found for this gene.
  • Cellular localizationNuclear

References for Recombinant Human PURG protein (ab88943)

ab88943 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab88943.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"