Overview

  • Product name
    Recombinant Human PUS7L protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MEEDTDYRIRFSSLCFFNDHVGFHGTIKSSPSDFIVIEIDEQGQLVNKTI DEPIFKISEIQLEPNNFPKKPKLDLQNLSLEDGRNQEVHTLIKYTDGDQN HQSGSEKEDTIVDGTSKCEEKADVLSSFLDEKTHELLNNFACDVREKWLS KTELIGLPPEFSIGRIVDKNQRASLHSAIRQKFPFLVTVGKNSEIVVKPN LEYKELCHLVSEEEAFDFFKYLDAKKENSKFTFKPDTNKDHRKAVHHFVN KKFGNLVETKSFSKMNCSAGNPNVVVTVRFREKAHKRGKRPLSECQEGKV IYTAFTLRKENLEMFEAIGFLAIKLGVIPSDFSYAGLKDKKAITYQAMVV RKVTPERLKNIEKEIEKKRMNVFNIRSVDDSLRLGQLKGNHFDIVIRNLK KQINDSANLRERIMEAIENVKKKGFVNYYGPQRFGKGRKVHTDQIGLALL KNEMMKAIKLFLTPEDLDDPVNRAKKYFLQTEDAKGTLSLMPEFKVRERA LLEALHRFGMTEEGCIQAWFSLPHSMRIFYVHAYTSKIWNEAVSYRLETY GARVVQGDLVCLDEDIDDENFQNSKIHLVTEEEGSANMYAIHQVVLPVLG YNIQYPKNKVGQWYHDILSRDGLQTCRFKVPTLKLNIPGCYRQILKHPCN LSYQLMEDHDIDVKTKGSHIDETALSLLISFDLDASCYATVCLKEIMKHD V
    • Amino acids
      1 to 701
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164392 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • DKFZp781B2386
    • FLJ34711
    • FLJ40012
    • Pseudouridylate synthase 7 homolog
    • Pseudouridylate synthase 7 homolog (S. cerevisiae)-like
    • Pseudouridylate synthase 7 homolog-like protein
    • PUS7L
    see all
  • Relevance
    DKFZP434G1415 also called PUS7L, belongs to the pseudouridine synthase truD family and contains 1 TRUD domain. The most abundant modification seen in structured RNAs (transfer, ribosomal, and splicing RNAs) is the isomerization of uridine (U) to pseudouridine (5-ribosyluracil). Pseudouridine is made by a set of enzymes called pseudouridine synthase, which select specific U residues in a polynucleotide chain for isomerization to pseudouridine.

Images

  • ab164392 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164392 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164392.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up