Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAFMEKPPAGKVLLDDTVPLTAAIEASQSLQSHTEYIIRVQRGISVENSW QIVRRYSDFDLLNNSLQIAGLSLPLPPKKLIGNMDREFIAERQKGLQNYL NVITTNHILSNCELVKKFLDPNNYSANYTEIALQQVSMFFRSEPKWEVVE PLKDIGWRIRKKYFLMKIKNQPKERLVLSWADLGPDKYLSDKDFQCLIKL LPSCLHPYIYRVTFATANESSALLIRMFNEKGTLKDLIYKAKPKDPFLKK YCNPKKIQGLELQQIKTYGRQILEVLKFLHDKGFPYGHLHASNVMLDGDT CRLLDLENSLLGLPSFYRSYFSQFRKINTLESVDVHCFGHLLYEMTYGRP PDSVPVDSFPPAPSMAVVAVLESTLSCEACKNGMPTISRLLQMPLFSDVL LTTSEKPQFKIPTKLKEALRIAKECIEKRLIEEQKQIHQHRRLTRAQSHH
    • Amino acids
      1 to 450
    • Tags
      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162884 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • FLJ20335
    • K-ATPase
    • Modulator of Na
    • Modulator of Na K ATPase
    • Modulator of Na K ATPase long form
    • MONaKA
    • PX domain containing protein kinase like protein
    • PX domain containing serine/threonine kinase
    • PX domain-containing protein kinase-like protein
    • PX ser/thr kinase v2
    • PX serine/threonine kinase
    • Pxk
    • PXK_HUMAN
    see all
  • Function
    Binds to and modulates brain Na,K-ATPase subunits ATP1B1 and ATP1B3 and may thereby participate in the regulation of electrical excitability and synaptic transmission. May not display kinase activity.
  • Tissue specificity
    Widely expressed in all tissues examined except in heart. Isoform 1 is expressed in high levels in the brain, skeletal muscle, spleen and testis. Isoform 7 expression has yet to be demonstrated.
  • Sequence similarities
    Belongs to the protein kinase superfamily.
    Contains 1 protein kinase domain.
    Contains 1 PX (phox homology) domain.
    Contains 1 WH2 domain.
  • Domain
    The protein kinase domain is predicted to be catalytically inactive.
  • Cellular localization
    Cytoplasm. Cell membrane. Also associates with the plasma membrane. Isoform 3 is present throughout the cell.
  • Information by UniProt

Images

  • ab162884 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162884 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162884.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up