Overview

  • Product nameRecombinant Human PYCR1 protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionP32322
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMSVGFIGAGQLAFALAKGFTAAGVLAAHKI MASSPDMDLATVSALRKMGVKLTPHNKETVQHSDVLFLAVKPHIIPFILD EIGADIEDRHIVVSCAAGVTISSIEKKLSAFRPAPRVIRCMTNTPVVVRE GATVYATGTHAQVEDGRLMEQLLSSVGFCTEVEEDLIDAVTGLSGSGPAY AFTALDALADGGVKMGLPRRLAVRLGAQALLGAAKMLLHSEQHPGQLKDN VSSPGGATIHALHVLESGGFRSLLINAVEASCIRTRELQSMADQEQVSPA AIKKTILDKVKLDSPAGTALSPSGHTKLLPRSLAPAGKD
    • Molecular weight36 kDa including tags
    • Amino acids1 to 319
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab101948 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 90 % SDS-PAGE.
    ab101948 is purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Glycerol, 20mM Tris HCl, pH 8.5

General Info

  • Alternative names
    • P5C
    • P5C reductase
    • P5C reductase 1
    • P5CR
    • P5CR 1
    • PIG45
    • PP222
    • Proliferation inducing protein 45
    • PYCR
    • PYCR 1
    • Pyrroline 5 carboxylate reductase 1
    • Pyrroline 5 carboxylate reductase 1 mitochondrial
    see all
  • RelevancePYCR1 is an enzyme that catalyzes the NAD(P)H-dependent conversion of pyrroline-5-carboxylate to proline. This enzyme may also play a physiologic role in the generation of NADP(+) in some cell types. It forms a homopolymer and localizes to the mitochondrion.
  • Cellular localizationMitochondrial

Recombinant Human PYCR1 protein images

  • 15% SDS-PAGE analysis of 3µg ab101948.

References for Recombinant Human PYCR1 protein (ab101948)

ab101948 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab101948.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"