Overview

  • Product name
    Recombinant Human PYCR1 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMSVGFIGAGQLAFALAKGFTAAGVLAAHKI MASSPDMDLATVSALRKMGVKLTPHNKETVQHSDVLFLAVKPHIIPFILD EIGADIEDRHIVVSCAAGVTISSIEKKLSAFRPAPRVIRCMTNTPVVVRE GATVYATGTHAQVEDGRLMEQLLSSVGFCTEVEEDLIDAVTGLSGSGPAY AFTALDALADGGVKMGLPRRLAVRLGAQALLGAAKMLLHSEQHPGQLKDN VSSPGGATIHALHVLESGGFRSLLINAVEASCIRTRELQSMADQEQVSPA AIKKTILDKVKLDSPAGTALSPSGHTKLLPRSLAPAGKD
    • Molecular weight
      36 kDa including tags
    • Amino acids
      1 to 319
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab101948 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 90 % SDS-PAGE.
    ab101948 is purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Glycerol, 20mM Tris HCl, pH 8.5

General Info

  • Alternative names
    • P5C
    • P5C reductase
    • P5C reductase 1
    • P5CR
    • P5CR 1
    • PIG45
    • PP222
    • Proliferation inducing protein 45
    • PYCR
    • PYCR 1
    • Pyrroline 5 carboxylate reductase 1
    • Pyrroline 5 carboxylate reductase 1 mitochondrial
    see all
  • Relevance
    PYCR1 is an enzyme that catalyzes the NAD(P)H-dependent conversion of pyrroline-5-carboxylate to proline. This enzyme may also play a physiologic role in the generation of NADP(+) in some cell types. It forms a homopolymer and localizes to the mitochondrion.
  • Cellular localization
    Mitochondrial

Images

  • 15% SDS-PAGE analysis of 3µg ab101948.

References

ab101948 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab101948.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up