Recombinant Human Pyrophosphatase 1 protein (ab123186)

Overview

  • Product name
    Recombinant Human Pyrophosphatase 1 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGSHMSGFSTEERAAPFSLEYRVFLKNEKG QYISPFHDIPIYADKDVFHMVVEVPRWSNAKMEIATKDPLNPIKQDVKKG KLRYVANLFPYKGYIWNYGAIPQTWEDPGHNDKHTGCCGDNDPIDVCEIG SKVCARGEIIGVKVLGILAMIDEGETDWKVIAINVDDPDAANYNDINDVK RLKPGYLEATVDWFRRYKVPDGKPENEFAFNAEFKDKDFAIDIIKSTHDH WKALVTKKTNGKGISCMNTTLSESPFKCDPDAARAIVDALPPPCESACTV PTDVDKWFHHQKN
    • Molecular weight
      35 kDa including tags
    • Amino acids
      1 to 289
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab123186 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 95 % SDS-PAGE.
    ab123186 is purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.03% DTT, 0.32% Tris HCl, 20% Glycerol, 1.17% Sodium chloride

General Info

  • Alternative names
    • cytosolic inorganic pyrophosphatase
    • diphosphate phosphohydrolase
    • inorganic diphosphatase
    • Inorganic pyrophosphatase
    • inorganic pyrophosphatase 1
    • IOPPP
    • IPYR_HUMAN
    • PP
    • PP1
    • PPA1
    • PPase
    • Pyp
    • pyrophosphatase, inorganic, 1
    • Pyrophosphate phospho hydrolase
    • Pyrophosphate phospho-hydrolase
    • SID6-8061
    see all
  • Tissue specificity
    Expressed ubiquitously.
  • Sequence similarities
    Belongs to the PPase family.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Recombinant Human Pyrophosphatase 1 protein images

  • 15% SDS-PAGE showing ab123186 (3µg).

References for Recombinant Human Pyrophosphatase 1 protein (ab123186)

ab123186 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab123186.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up