Recombinant Human Pyrophosphatase 1 protein (ab123186)

Overview

  • Product nameRecombinant Human Pyrophosphatase 1 protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionQ15181
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMGSHMSGFSTEERAAPFSLEYRVFLKNEKG QYISPFHDIPIYADKDVFHMVVEVPRWSNAKMEIATKDPLNPIKQDVKKG KLRYVANLFPYKGYIWNYGAIPQTWEDPGHNDKHTGCCGDNDPIDVCEIG SKVCARGEIIGVKVLGILAMIDEGETDWKVIAINVDDPDAANYNDINDVK RLKPGYLEATVDWFRRYKVPDGKPENEFAFNAEFKDKDFAIDIIKSTHDH WKALVTKKTNGKGISCMNTTLSESPFKCDPDAARAIVDALPPPCESACTV PTDVDKWFHHQKN
    • Molecular weight35 kDa including tags
    • Amino acids1 to 289
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab123186 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 95 % SDS-PAGE.
    ab123186 is purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.03% DTT, 0.32% Tris HCl, 20% Glycerol, 1.17% Sodium chloride

General Info

  • Alternative names
    • cytosolic inorganic pyrophosphatase
    • diphosphate phosphohydrolase
    • inorganic diphosphatase
    • Inorganic pyrophosphatase
    • inorganic pyrophosphatase 1
    • IOPPP
    • IPYR_HUMAN
    • PP
    • PP1
    • PPA1
    • PPase
    • Pyp
    • pyrophosphatase, inorganic, 1
    • Pyrophosphate phospho hydrolase
    • Pyrophosphate phospho-hydrolase
    • SID6-8061
    see all
  • Tissue specificityExpressed ubiquitously.
  • Sequence similaritiesBelongs to the PPase family.
  • Cellular localizationCytoplasm.
  • Information by UniProt

Recombinant Human Pyrophosphatase 1 protein images

  • 15% SDS-PAGE showing ab123186 (3µg).

References for Recombinant Human Pyrophosphatase 1 protein (ab123186)

ab123186 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab123186.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"