Recombinant human Pyruvate kinase isozyme M1 protein (ab196081)

Overview

  • Product name
    Recombinant human Pyruvate kinase isozyme M1 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MSKPHSEAGTAFIQTQQLHAAMADTFLEHMCRLDIDSPPITARNTGIICT IGPASRSVETLKEMIKSGMNVARLNFSHGTHEYHAETIKNVRTATESFAS DPILYRPVAVALDTKGPEIRTGLIKGSGTAEVELKKGATLKITLDNAYME KCDENILWLDYKNICKVVEVGSKIYVDDGLISLQVKQKGADFLVTEVENG GSLGSKKGVNLPGAAVDLPAVSEKDIQDLKFGVEQDVDMVFASFIRKASD VHEVRKVLGEKGKNIKIISKIENHEGVRRFDEILEASDGIMVARGDLGIE IPAEKVFLAQKMMIGRCNRAGKPVICATQMLESMIKKPRPTRAEGSDVAN AVLDGADCIMLSGETAKGDYPLEAVRMQHLIAREAEAAIYHLQLFEELRR LAPITSDPTEATAVGAVEASFKCCSGAIIVLTKSGRSAHQVARYRPRAPI IAVTRNPQTARQAHLYRGIFPVLCKDPVQEAWAEDVDLRVNFAMNVGKAR GFFKKGDVVIVLTGWRPGSGFTNTMRVVPVP
    • Molecular weight
      59 kDa including tags
    • Amino acids
      1 to 531
    • Tags
      His tag N-Terminus
    • Additional sequence information
      GenBank Accession No. NM_182470

Specifications

Our Abpromise guarantee covers the use of ab196081 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    Specific Activity: ≥54 pmol/min/µg
    Assay Conditions: A 50 µl reaction is conducted in a buffer containing 50 mM Tris (pH 7.4), 10 mM MgCl2, 50 mM KCl, 2 mM ADP, 10 mM phosphoenolpyruvate (PEP) at room temperature for 15 min. ATP production is detected using Kinase Assay.

  • Applications

    SDS-PAGE

    Functional Studies

  • Purity
    >= 80 % SDS-PAGE.

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Preservative: 0.45% Imidazole
    Constituents: 0.63% Tris HCl, 0.64% Sodium chloride, 0.02% Potassium chloride, 20% Glycerol, 0.05% DTT

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names
    • CTHBP
    • Cytosolic thyroid hormone-binding protein
    • KPYM_HUMAN
    • OIP-3
    • Opa-interacting protein 3
    • p58
    • pkm
    • Pyruvate kinase 2/3
    • Pyruvate kinase isozymes M1/M2
    • Pyruvate kinase muscle isozyme
    • THBP1
    • Thyroid hormone-binding protein 1
    • Tumor M2-PK
    see all
  • Function
    Glycolytic enzyme that catalyzes the transfer of a phosphoryl group from phosphoenolpyruvate (PEP) to ADP, generating ATP. Stimulates POU5F1-mediated transcriptional activation. Plays a general role in caspase independent cell death of tumor cells. The ratio betwween the highly active tetrameric form and nearly inactive dimeric form determines whether glucose carbons are channeled to biosynthetic processes or used for glycolytic ATP production. The transition between the 2 forms contributes to the control of glycolysis and is important for tumor cell proliferation and survival.
  • Tissue specificity
    Specifically expressed in proliferating cells, such as embryonic stem cells, embryonic carcinoma cells, as well as cancer cells.
  • Pathway
    Carbohydrate degradation; glycolysis; pyruvate from D-glyceraldehyde 3-phosphate: step 5/5.
  • Sequence similarities
    Belongs to the pyruvate kinase family.
  • Post-translational
    modifications
    Phosphorylated upon DNA damage, probably by ATM or ATR.
    ISGylated.
    Under hypoxia, hydroxylated by EGLN3.
  • Cellular localization
    Cytoplasm. Nucleus. Translocates to the nucleus in response to different apoptotic stimuli. Nuclear translocation is sufficient to induce cell death that is caspase independent, isoform-specific and independent of its enzymatic activity.
  • Information by UniProt

Images

  • Specific activity of ab196081 was determined to be 54 pmol/min/μg

  • SDS-PAGE using 13.5 µg ab196081 (Lane 1). Lane 2 shows protein marker.

References

ab196081 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab196081.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up