Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MVGEMETKEKPKPTPDYLMQLMNDKKLMSSLPNFCGIFNHLERLLDEEIS RVRKDMYNDTLNGSTEKRSAELPDAVGPIVQLQEKLYVPVKEYPDFNFVG RILGPRGLTAKQLEAETGCKIMVRGKGSMRDKKKEEQNRGKPNWEHLNED LHVLITVEDAQNRAEIKLKRAVEEVKKLLVPAAEGEDSLKKMQLMELAIL NGTYRDANIKSPALAFSLAATAQAAPRIITGPAPVLPPAALRTPTPAGPT IMPLIRQIQTAVMPNGTPHPTAAIVPPGPEAGLIYTPYEYPYTLAPATSI LEYPIEPSGVLGMAFPTKG
    • Amino acids
      1 to 319
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab152988 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • DKFZp586I0923
    • HKQ
    • Homolog of mouse quaking QKI KH domain RNA binding protein
    • Hqk
    • HQK1
    • HqkI
    • OTTHUMP00000017581
    • OTTHUMP00000017582
    • OTTHUMP00000017583
    • Protein quaking
    • QK
    • QK1
    • QK3
    • QKI
    • QKI_HUMAN
    • QKI1
    • Quaking homolog
    • Quaking homolog KH domain RNA binding
    • Quaking homolog KH domain RNA binding mouse
    • Quaking isoform 1
    • Quaking protein
    • RNA binding protein HQK
    see all
  • Function
    RNA-binding protein that plays a central role in myelinization (PubMed:16641098). Binds to the 5'-NACUAAY-N(1,20)-UAAY-3' RNA core sequence. Regulates target mRNA stability (PubMed:23630077). In addition, acts by regulating pre-mRNA splicing, mRNA export and protein translation. Required to protect and promote stability of mRNAs such as MBP and CDKN1B. Regulator of oligodendrocyte differentiation and maturation in the brain that may play a role in myelin and oligodendrocyte dysfunction in schizophrenia (PubMed:16641098). Participates in mRNA transport by regulating the nuclear export of MBP mRNA. Also involved in regulation of mRNA splicing of MAG pre-mRNA. Acts as a translational repressor.
  • Tissue specificity
    Expressed in the frontal cortex of brain. Down-regulated in the brain of schizophrenic patients.
  • Sequence similarities
    Contains 1 KH domain.
  • Domain
    The KH domain and the Qua2 region are involved in RNA binding.
  • Post-translational
    modifications
    Methylated by PRMT1.
    Tyrosine phosphorylated at its C-terminus, probably by FYN. Phosphorylation leads to decreased mRNA-binding affinity, affecting transport and/or stabilization of MBP mRNA.
  • Cellular localization
    Nucleus. Cytoplasm.
  • Information by UniProt

Images

  • ab152988 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab152988 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152988.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up