Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNS SALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQA DWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWN NRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDG EEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLI GAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYG GVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKI LQVFVLEYLHL
    • Amino acids
      1 to 361
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161786 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 5730422A13Rik
    • EC
    • GCT
    • Glutaminyl cyclase
    • Glutaminyl peptide cyclotransferase
    • Glutaminyl tRNA cyclotransferase
    • Glutaminyl-peptide cyclotransferase
    • Glutaminyl-tRNA cyclotransferase
    • Glutamyl cyclase
    • QC
    • qpct
    • QPCT_HUMAN
    • sQC
    see all
  • Function
    Responsible for the biosynthesis of pyroglutamyl peptides. Has a bias against acidic and tryptophan residues adjacent to the N-terminal glutaminyl residue and a lack of importance of chain length after the second residue. Also catalyzes N-terminal pyroglutamate formation. In vitro, catalyzes pyroglutamate formation of N-terminally truncated form of APP amyloid-beta peptides [Glu-3]-beta-amyloid. May be involved in the N-terminal pyroglutamate formation of several amyloid-related plaque-forming peptides.
  • Sequence similarities
    Belongs to the glutaminyl-peptide cyclotransferase family.
  • Cellular localization
    Secreted.
  • Information by UniProt

Images

  • ab161786 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161786 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161786.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up