Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMDAEGLALLLPPVTLAALVDSWLREDCPGL NYAALVSGAGPSQAALWAKSPGVLAGQPFFDAIFTQLNCQVSWFLPEGSK LVPVARVAEVRGPAHCLLLGERVALNTLARCSGIASAAAAAVEAARGAGW TGHVAGTRKTTPGFRLVEKYGLLVGGAASHRYDLGGLVMVKDNHVVAAGG VEKAVRAARQAADFALKVEVECSSLQEAVQAAEAGADLVLLDNFKPEELH PTATVLKAQFPSVAVEASGGITLDNLPQFCGPHIDVISMGMLTQAAPALD FSLKLFAKEVAPVPKIH
    • Molecular weight
      33 kDa including tags
    • Amino acids
      1 to 297
    • Tags
      His tag N-Terminus

Associated products

Specifications

Our Abpromise guarantee covers the use of ab100986 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 95 % SDS-PAGE.
    purified by using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: 0% None
    Constituents: 10% Glycerol, 20mM Tris HCl, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • NADC_HUMAN
    • Nicotinate nucleotide pyrophosphorylase (carboxylating)
    • Nicotinate-nucleotide pyrophosphorylase [carboxylating]
    • QAPRTase
    • QPRT
    • QPRTase
    • Quinolinate phosphoribosyltransferase
    • Quinolinate phosphoribosyltransferase [decarboxylating]
    see all
  • Function
    Involved in the catabolism of quinolinic acid (QA).
  • Pathway
    Cofactor biosynthesis; NAD(+) biosynthesis; nicotinate D-ribonucleotide from quinolinate: step 1/1.
  • Sequence similarities
    Belongs to the nadC/modD family.
  • Information by UniProt

Recombinant Human QPRT protein images

  • ab100986 at 3 µg being analysed by 15% SDS PAGE.

References for Recombinant Human QPRT protein (ab100986)

ab100986 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab100986.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up