Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MFLSPGEGPATEGGGLGPGEEAPKKKHRRNRTTFTTYQLHQLERAFEASH YPDVYSREELAAKVHLPEVRVQVWFQNRRAKWRRQERLESGSGAVAAPRL PEAPALPFARPPAMSLPLEPWLGPGPPAVPGLPRLLGPGPGLQASFGPHA FAPTFADGFALEEASLRLLAKEHAQALDRAWPPA
    • Amino acids
      1 to 184
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164669 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ARMD6
    • CORD11
    • Macular degeneration, age related 6, included
    • MGC15631
    • Q50 type retinal homeobox
    • Q50-type retinal homeobox protein
    • QRX
    • rax2
    • RAX2_HUMAN
    • RAXL1
    • Retina and anterior neural fold homeobox like 1
    • Retina and anterior neural fold homeobox protein 2
    • Retina and anterior neural fold homeobox-like protein 1
    see all
  • Function
    May be involved in modulating the expression of photoreceptor specific genes. Binds to the Ret-1 and Bat-1 element within the rhodopsin promoter.
  • Involvement in disease
    Defects in RAX2 are the cause of age-related macular degeneration type 6 (ARMD6) [MIM:613757]. ARMD is in most patients manifest as ophthalmoscopically visible yellowish accumulations of protein and lipid (known as drusen) that lie beneath the retinal pigment epithelium and within an elastin-containing structure known as Bruch's membrane. ARMD is likely to be a mechanistically heterogeneous group of disorders.
    Defects in RAX2 are the cause of cone-rod dystrophy type 11 (CORD11) [MIM:610381]. CORD is characterized by the initial degeneration of cone photoreceptor cells, thus causing early loss of visual acuity and color vision, followed by the degeneration of rod photoreceptor cells and leading to progressive night blindness and peripheral visual field loss.
  • Sequence similarities
    Contains 1 homeobox DNA-binding domain.
  • Domain
    The Homeobox transactivates the Ret-1 element in the presence of CRX and NRL.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab164669 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164669 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164669.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up